NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300016768

3300016768: Metatranscriptome of marine eukaryotic communities from North Pacific Ocean in K/2 Ian medium, 22 C, 35 psu salinity and 347 ?mol photons light - unclassified eukaryote RCC 2335 (MMETSP1312)



Overview

Basic Information
IMG/M Taxon OID3300016768 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212070 | Ga0186358
Sample NameMetatranscriptome of marine eukaryotic communities from North Pacific Ocean in K/2 Ian medium, 22 C, 35 psu salinity and 347 ?mol photons light - unclassified eukaryote RCC 2335 (MMETSP1312)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size13355705
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationNorth Pacific Ocean
CoordinatesLat. (o)35.21666667Long. (o)139.6166667Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F079415Metagenome / Metatranscriptome115N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186358_103875Not Available1338Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186358_103875Ga0186358_1038751F079415GGCKTGVTRARIKRNETGSGATQTRASRRPRTRPSAPPRHKARPPTKRKMKSTALAVALAVALAVALAVATVSTCLAEKEESYFEAAYRFEATHFCETMTTNNKQCGWVGMDDPRYENDREVKINQIGCPMCGTEWGGWYEANEAGTGVSLRYPPNAIIGPGIRGAGYSQYFPRFLSLGCRGKKVEVQAVYKLIDAGEEQNGSGPYYAGLSLTDTPWYPKNLTRCSIGTGQEPSNTAADCRECQQSASGEGGCPIEKDTWYMDTMILDMPEQCPPSQDGPVMPSILVNAYQTLNVSAFTATPIT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.