3300016759: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in ASW medium, resuspended in ASW w/o nitrate, 20 C, 29 psu salinity and 688 ?mol photons light - Chaetoceros curvisetus (MMETSP0718)

Overview

Basic Information

• IMG/M Taxon OID: 3300016759
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0128947 | Gp0212040 | Ga0186328
• Sample Name: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in ASW medium, resuspended in ASW w/o nitrate, 20 C, 29 psu salinity and 688 ?mol photons light - Chaetoceros curvisetus (MMETSP0718)
• Sequencing Status: Permanent Draft
• Sequencing Center: National Center for Genome Resources
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 5918753
• Sequencing Scaffolds: 0
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → mesotrophic water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Pacific Ocean
• Coordinates
  • Lat. (^o): 32.9
  • Long. (^o): -117.255
  • Alt. (m): N/A
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059360	Metagenome / Metatranscriptome	134	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
No data available in table

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0186328_101237	Ga0186328_1012371	F059360	MTAFSCKVLSFKMIMTLLKEVLVPANLVPAAAVIREGQALSEITGRKAFVDGIVS