NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300015048

3300015048: Groundwater microbial communities from the Olkiluoto Island deep subsurface site, Finland - KR13_J_MetaG



Overview

Basic Information
IMG/M Taxon OID3300015048 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0127568 | Gp0198143 | Ga0180013
Sample NameGroundwater microbial communities from the Olkiluoto Island deep subsurface site, Finland - KR13_J_MetaG
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size62746559
Sequencing Scaffolds2
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Archaea1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameGroundwater Microbial Communities From Three Deep Subsurface Sites In Europe
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Three Deep Subsurface Sites In Europe

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater biomeplanetary subsurface zonegroundwater
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationFinland: the Olkiluoto Island
CoordinatesLat. (o)61.2418Long. (o)21.4803Alt. (m)N/ADepth (m)410
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F072481Metagenome / Metatranscriptome121Y
F096722Metagenome104Y
F098573Metagenome / Metatranscriptome103Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0180013_130445Not Available574Open in IMG/M
Ga0180013_130566All Organisms → cellular organisms → Archaea573Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0180013_121512Ga0180013_1215122F098573MILPAFVVRYKRYDTDALEKFMTLLFITEDSYRIAGISQALWMDTQLAGTWAALEASAEVAIAPRALWGLVQWVGQLSPAQLNLALGVEPPSHIIEDEKHVTQNGARAYVPIVYAPKEALIWWIDYIQSVSADALQASLERFKALSDRLSQKRSAERLWMVGMPLKKP*
Ga0180013_130445Ga0180013_1304451F096722MSDEKESYTGPIEQKVNSMMETTGDEISNFTQKGPDVFINETVQDIRILNLNRCILYLAKEIDKLAKSIK*
Ga0180013_130566Ga0180013_1305661F072481ADDAKGRKDGTKPVFRPDFHSEKHVRCKHCGETYTEKEIKLDPKTGKWVCKHHPKCGGVEWHPF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.