Basic Information | |
---|---|
IMG/M Taxon OID | 3300014956 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121297 | Gp0151606 | Ga0134434 |
Sample Name | Human fecal microbial communities from obese patients in Germany - AS50_3 |
Sequencing Status | Permanent Draft |
Sequencing Center | University of Hohenheim |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 134834199 |
Sequencing Scaffolds | 5 |
Novel Protein Genes | 5 |
Associated Families | 5 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii → Faecalibacterium prausnitzii M21/2 | 1 |
Not Available | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → unclassified Oscillospiraceae → Oscillospiraceae bacterium | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Fecal Microbial Communities From Obese Patients In Germany |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Germany | |||||||
Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F044554 | Metagenome | 154 | N |
F051936 | Metagenome | 143 | N |
F088914 | Metagenome | 109 | N |
F090513 | Metagenome | 108 | N |
F101355 | Metagenome | 102 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0134434_1008414 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 2069 | Open in IMG/M |
Ga0134434_1009178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1921 | Open in IMG/M |
Ga0134434_1015037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii → Faecalibacterium prausnitzii M21/2 | 1239 | Open in IMG/M |
Ga0134434_1035682 | Not Available | 568 | Open in IMG/M |
Ga0134434_1038691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → unclassified Oscillospiraceae → Oscillospiraceae bacterium | 527 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0134434_1008414 | Ga0134434_10084141 | F051936 | TGQVLFFPLALRGKAFGFSGLSETAVMTPVIINFSLLLIIR* |
Ga0134434_1009178 | Ga0134434_10091782 | F090513 | MAKCVRKMEWKLLHIKHILYMRPFGALKIAPQSVGNKNGTKAVLQGWAAAFVPYMLSFTY |
Ga0134434_1015037 | Ga0134434_10150374 | F101355 | PFQHGIADMAFWFIQWYLPSAQLPQPKGAGAVFPYVLPLCSYFFKSFVTEMSIFICMHKCLAQTGRLRGSSCHIVVAAKRACACTLLWISDHFHKKLLPYVLFSFLKFI* |
Ga0134434_1035682 | Ga0134434_10356822 | F044554 | VLAGRFIPVLCASIARLFPCRTEIARCLTLDFAISRYLFLSFSFSFRANFAQALFSSLLFVSDTRAKSILFLLFENEIAHLQGQYRFNSHRYC |
Ga0134434_1038691 | Ga0134434_10386912 | F088914 | VGRILPVCSGFFVFWSRKEGANYQISVKSFSNLDSYDIIQLYIMTELTDGRVSDRLFSVPYTPKENIKNPGEFIVFSVWYAAKALEMDVK* |
⦗Top⦘ |