Basic Information | |
---|---|
IMG/M Taxon OID | 3300014772 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121303 | Gp0151702 | Ga0134530 |
Sample Name | Wastewater microbial communities from medical facility sewage samples near Freiburg, Germany - C1751 |
Sequencing Status | Permanent Draft |
Sequencing Center | University of Freiburg |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 65151822 |
Sequencing Scaffolds | 5 |
Novel Protein Genes | 5 |
Associated Families | 5 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Gemmiger → Gemmiger formicilis | 1 |
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Wastewater Microbial Communities From Medical Facility Sewage Samples Near Freiburg, Germany |
Type | Engineered |
Taxonomy | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Medical Facility Sewage Samples Near Freiburg, Germany |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Germany: Freiburg | |||||||
Coordinates | Lat. (o) | 48.0 | Long. (o) | 8.0 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F041054 | Metagenome / Metatranscriptome | 160 | Y |
F042737 | Metagenome / Metatranscriptome | 157 | Y |
F047125 | Metagenome / Metatranscriptome | 150 | N |
F087334 | Metagenome | 110 | N |
F089054 | Metagenome | 109 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0134530_1000021 | Not Available | 12699 | Open in IMG/M |
Ga0134530_1000177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 7018 | Open in IMG/M |
Ga0134530_1002796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2089 | Open in IMG/M |
Ga0134530_1003205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Gemmiger → Gemmiger formicilis | 1912 | Open in IMG/M |
Ga0134530_1020521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 621 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0134530_1000021 | Ga0134530_10000215 | F089054 | MLTSGKFLVSFEVPGPLPGTTEGFCEEMNVVYRTEELNTYLRYPKQEINPGHKHSTYIRLKLREILEVNLRDITIIDIISLP* |
Ga0134530_1000177 | Ga0134530_10001778 | F042737 | MKLTEKSNEVYSYVKENGGRVAVEELCEALGRAPRSINANVTDLAKKSLVVREKVTAEGEDAKDMTYVVLTEEGKTFVPSDDEE* |
Ga0134530_1002796 | Ga0134530_10027963 | F047125 | MEVALLLMVLGVMLSGFRAADALDHMRKEIIRQEGKRRGWWS* |
Ga0134530_1003205 | Ga0134530_10032051 | F087334 | MASRYPFVGAAAYLFPKNAIKMLSFSTSGKGSILLYPFRSSPLLAITFLYHPKDFFLYRAAALFEYREKHQ* |
Ga0134530_1020521 | Ga0134530_10205211 | F041054 | RNCKDIGVNLQRIMKRLMQNDNLVKLLYYTDKDPLSNENLTEEQKESEIFEKLIKIVPRIGPKETASSIIALRVVTGKKNQDNSEFKDVLISVEVFVPLTQWIIKGTNLRPFAILGEIEESLDGKMIEGLGKMSGGDFELNFLTEEISSYKQEFIITSYD* |
⦗Top⦘ |