NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300014288

3300014288: Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal/plastic -P00191



Overview

Basic Information
IMG/M Taxon OID3300014288 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118444 | Gp0135683 | Ga0121464
Sample NameUrban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal/plastic -P00191
Sequencing StatusPermanent Draft
Sequencing CenterWeill Cornell Medical College
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size16695303
Sequencing Scaffolds17
Novel Protein Genes17
Associated Families15

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available5
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays9
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f51
All Organisms → cellular organisms → Eukaryota1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameUrban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa
TypeEngineered
TaxonomyEngineered → Built Environment → City → Subway → Unclassified → City Subway Metal/Plastic → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationUSA:New York City
CoordinatesLat. (o)40.63Long. (o)-73.99Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002471Metagenome / Metatranscriptome556Y
F002994Metagenome / Metatranscriptome514Y
F003406Metagenome / Metatranscriptome488Y
F007409Metagenome / Metatranscriptome351Y
F009131Metagenome / Metatranscriptome322Y
F014592Metagenome / Metatranscriptome261Y
F020862Metagenome / Metatranscriptome221Y
F032187Metagenome / Metatranscriptome180Y
F037171Metagenome / Metatranscriptome168N
F043815Metagenome / Metatranscriptome155Y
F048829Metagenome / Metatranscriptome147Y
F062643Metagenome / Metatranscriptome130Y
F063479Metagenome / Metatranscriptome129Y
F065522Metagenome127N
F095123Metagenome / Metatranscriptome105N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0121464_100654Not Available1909Open in IMG/M
Ga0121464_101372All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1429Open in IMG/M
Ga0121464_102747All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1028Open in IMG/M
Ga0121464_103070All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays977Open in IMG/M
Ga0121464_103904All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays861Open in IMG/M
Ga0121464_104751Not Available767Open in IMG/M
Ga0121464_105473All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays709Open in IMG/M
Ga0121464_105626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis698Open in IMG/M
Ga0121464_106496All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5642Open in IMG/M
Ga0121464_106534Not Available640Open in IMG/M
Ga0121464_107809All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays576Open in IMG/M
Ga0121464_107858All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays574Open in IMG/M
Ga0121464_108335Not Available554Open in IMG/M
Ga0121464_108523Not Available546Open in IMG/M
Ga0121464_108621All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays542Open in IMG/M
Ga0121464_109324All Organisms → cellular organisms → Eukaryota516Open in IMG/M
Ga0121464_109604All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays506Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0121464_100654Ga0121464_1006541F063479MSERNWAETHWIARSTRGGGRPKSGEVDLGPPVKSGRVRGLGELHGLLAELAEALARLGGGWSGLATVAEALAAMAGGIKLAGAKERWLAGEGECGAKRGAPGEAL*
Ga0121464_101372Ga0121464_1013722F007409MSEAAKKAAAEMKLSLDEEKNLGFLIAMSKTNTEKITREILEGLSEDTGDSESYDVDSGGEDSEDRPWRPSHSVYGKSTIKENHLVNMRGRYFRDLSIVRADEGEKTCPHPEENEVV
Ga0121464_102747Ga0121464_1027472F048829ASENEAFMFQNLVGEKLSKAEIEELREYAKSCGYKPGALLFGGIDDEKLDCIRDQTGAKVIGTLSKSIGFPKLETDISRYRRQHIVGSLFYSNFKVNYFSPDFYCFG*
Ga0121464_103070Ga0121464_1030701F009131REIKDLQKQLARAKEERALEETKRELSDFMVNKLESKVKELRTSQGKCYVKSVECVNKIKSSFASVGAFSSEENFSRGNPEGPLEWISHEAEAFEEILNSRGDICAFSGARGTASVLEKKGCGHVKFLAQSEATLSSEDIKDPSAEASVVGGKFFTDIWNDGGRGMAREIIERSEKGIHDARRVADAAERSREPEGQLGTN*
Ga0121464_103904Ga0121464_1039041F007409MSEDKKTAAEMKLSLDEEKNLGFLIAMSKTNTEKITKEILEGLSEDTGDSDSYDVDSGGEDSEDRPWRPSHSVYGKSTIKENHLVNMR
Ga0121464_104751Ga0121464_1047511F014592VKKLKASFARVGAFSSEENFTRGNPEGPIEWIDHEAEAFEEILNSRGDICAFSGARGIATILEKKGCEHVKILAQSEAALSFEDARDPSAEASIIGGKFFTDIWDNGGREMAGEIIRRSEKGIHDAREVAEAAEKSAEPEGQIGIN*
Ga0121464_105473Ga0121464_1054731F020862DEAEKNSNLQKSLKELQEKCVNIGNQCLQRLKQVFNSVGASAEKFSPLVENLPETFEHIKGEVDALDEVIAGHADFCALLASRGTATAFLKAGCTHGNIVNRPNFSLSASDLLDIPSLARSIGNRFMTQIWVSGGRKMAGDEARSHLKPVRNLCLLLLPSPLKFVPFLLCCLIYTG*
Ga0121464_105626Ga0121464_1056261F037171MYVCARIENDPVEEPEEFAGEAPEQQSFGGGKCPLTYLCPIHSLIHLPHYTFIPKD*LAFVIHVL
Ga0121464_106496Ga0121464_1064962F065522MTRQISTLEEKHSRDQAELVQRCADFEEKYSQSQTELGQVSAALDDANALSSSLHAQLDSEKVIYKTVLCLAVFLLLAWFLKELIFVCRKKSVSLLLLVTILTDCTVILATR*
Ga0121464_106534Ga0121464_1065341F043815KGRGDGLHENFGCYNFAYRKTTKFPVISYRSKWPAGWKSEWFYVKVDKDEDKLVQSPLELTFGETRPRCNMIRGSPSQTAMAEFRVISDHIGTRDLVQEFLAFKVFPTMRDWEMPKLEGEKKKGELVRLPYHYKFKKHFKKPCQKWLDTIEIMCNDILGNYSKKEDQLMTAAFGSRPKRRLNRVLDALNFDYPDYEQLGGDAGGPKRKRIAS
Ga0121464_107809Ga0121464_1078091F095123ELQALPTIVEGFMSYASLVTCEGAMNALSREGCRHFEVFDQADEDFDRDIYKVEDPVVKESAGALYDRMWGPHGREVVRERAETARAQVTFSFVWCLLDVGCVCVC*
Ga0121464_107858Ga0121464_1078581F002471CSEHLVSISKLNDEVASLNAQLKTSKSEVDKIKFARDAYTVGRHPSIKDGLGFKREAKNLTSHKAPIFVKEKGKAPMASNAKKNHAFMYYDRRNARNAYNDFDSHVYDSHAMFASSSSYKHDRDMPRRNIAHVPRKNVIHAPRKVVNEPSIIYCALNTSFAICRKDRKIVARKLGAKCKGDRTCIWVPKD
Ga0121464_108335Ga0121464_1083351F002994MKKDDLLDTQEDFLIKENKKHVKVKNAYALEVEKCEKLSSELSTCREMIDNLRNENASLNKVDSHVCNVSIPNPRDNNDDLLARIDELNISLASLRDENKKLLAKAKDFDVCKITISDLRDKNDILHAKIVELNSCKPSTSTIEHVTICTRCRDVDINAIHDHMSLIKQQND
Ga0121464_108523Ga0121464_1085231F043815KEKLVQSPLELIFGETRPQCRIGDLKGPTWAALGEFEIISEHIGTRDLVQEFLAFKVFPTLKEWEMPKLEGEKKKGELVRLPYYFKFKKFFKKPCKEWLDTVEVMCNEILGNYSKKEDQLMTAAFGARPKRRLNRVLDALGFEYPDYEQLNKGAEGLKRKRVAEALIRDEEIPAKEKKVF
Ga0121464_108621Ga0121464_1086211F003406MKEWFYVKNDLKAREDIKEIIMRPIWQLFGLRKPKVEIDEASEACQRPFSTVCAFIGTRDLVQEHVAYRIWPLIDSWEMPKEAITNPSEGGLVRLKYTFRFGDQFVEPDDNWLKCVENTSDELLGAYSKSEDNALSAVFGSRKKKRLNRVFDAIRFV
Ga0121464_109324Ga0121464_1093241F032187LFAVCNSNIAVSSLPSEPAEASPGPHPKGDDEIRKMAEAIMDKIVNQLLNEAAEIVLRED
Ga0121464_109604Ga0121464_1096041F062643MVVAQTPDQRVALEGSIPTGLALGSAECTELVPAGLLQAASGGGLAPGYQLISPDLGIPSLFSNLQVMCCALV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.