Basic Information | |
---|---|
IMG/M Taxon OID | 3300013901 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118445 | Gp0134452 | Ga0116652 |
Sample Name | Baboon gut microbial communities from fecal samples in Kenya - M12 |
Sequencing Status | Permanent Draft |
Sequencing Center | Duke University |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 86287825 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Baboon Gut Microbial Communities From Fecal Samples In Kenya |
Type | Host-Associated |
Taxonomy | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Baboon Gut → Baboon Gut Microbial Communities From Fecal Samples In Kenya |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | ||||||||
Coordinates | Lat. (o) | 2.717 | Long. (o) | 37.1 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F032286 | Metagenome / Metatranscriptome | 180 | Y |
F092227 | Metagenome | 107 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0116652_1003693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium | 2409 | Open in IMG/M |
Ga0116652_1010697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1150 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0116652_1003693 | Ga0116652_10036932 | F092227 | MKEQKQKRWLRIGCLILAGVFALSLLGSVIMMLLY* |
Ga0116652_1010697 | Ga0116652_10106971 | F032286 | FDTRLFAGNAADDTLVTGSTFRFCRLVCLFVKRRNIILNSKRRSLLNRTLFRADNRTEQKTISPFSLSLIFTFDFAALSERRSCPGLSPRRFVLLGALDATLRRRTYPVRTVMQFSRFRCDCKTILAKNIALSRISKRSENAPKNADFHAYGQDRKRAEI* |
⦗Top⦘ |