Basic Information | |
---|---|
IMG/M Taxon OID | 3300013392 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0127568 | Gp0198145 | Ga0180015 |
Sample Name | Groundwater microbial communities from the Olkiluoto Island deep subsurface site, Finland - KR13_S2_MetaG |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 145904395 |
Sequencing Scaffolds | 4 |
Novel Protein Genes | 4 |
Associated Families | 4 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1 |
Not Available | 2 |
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Groundwater Microbial Communities From Three Deep Subsurface Sites In Europe |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Three Deep Subsurface Sites In Europe |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | freshwater biome → planetary subsurface zone → groundwater |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Finland: the Olkiluoto Island | |||||||
Coordinates | Lat. (o) | 61.2418 | Long. (o) | 21.4803 | Alt. (m) | N/A | Depth (m) | 410 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F056321 | Metagenome / Metatranscriptome | 137 | N |
F061521 | Metagenome / Metatranscriptome | 131 | Y |
F065254 | Metagenome | 128 | Y |
F093357 | Metagenome | 106 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0180015_1007332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2213 | Open in IMG/M |
Ga0180015_1051903 | Not Available | 656 | Open in IMG/M |
Ga0180015_1063741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans | 580 | Open in IMG/M |
Ga0180015_1069159 | Not Available | 553 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0180015_1007332 | Ga0180015_10073323 | F065254 | VALNKGSEQAEKASVATETLLWGCPITNFKATLPFNRMNQSRRGGIAAFKKRPHGPALARFKGYN* |
Ga0180015_1051903 | Ga0180015_10519031 | F061521 | MNEAQVRIEIERIVNLVVGFGWTKVEEKTSAGEVLLTLRKAVPVTSVS* |
Ga0180015_1063741 | Ga0180015_10637412 | F093357 | MERIIQKKMKNFEQAWQIKRFLAERGESISSLSRKLNRPFGSVANNIYGYRANAQLQREIADFLGKPVAKLFGGAGPVRG* |
Ga0180015_1069159 | Ga0180015_10691592 | F056321 | METPAPTPIIYVHVEFYRGVKAIAQFLGVHERTAQAFLHDGKIPGKKDGTGTWVLTNLDYFTSLQR* |
⦗Top⦘ |