NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300011297

3300011297: Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN I3 S16 L6_A metaT (Metagenome Metatranscriptome) (version 2)



Overview

Basic Information
IMG/M Taxon OID3300011297 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114292 | Gp0127494 | Ga0138401
Sample NameSeawater microbial communities from Saanich Inlet, British Columbia, Canada - KN I3 S16 L6_A metaT (Metagenome Metatranscriptome) (version 2)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size48158882
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha1_Bin11

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationSouthern Atlantic ocean
CoordinatesLat. (o)-28.2362Long. (o)-38.4949Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025846Metagenome / Metatranscriptome200Y
F076161Metagenome / Metatranscriptome118N
F097512Metagenome / Metatranscriptome104Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0138401_1016020Not Available838Open in IMG/M
Ga0138401_1019262Not Available752Open in IMG/M
Ga0138401_1077792All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha1_Bin1593Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0138401_1016020Ga0138401_10160201F097512SAPETLEKSFTKDFSPILKDARENGYEGLSIVAQNILSGKYYKPTPEEVGGY*
Ga0138401_1019262Ga0138401_10192623F025846GNVMAGQTVPMVEMKPTVLLHHVKIKDYGIVEMDSVFQHPMFVMDQTNFVTLDGDLTVLMAQMKA*
Ga0138401_1077792Ga0138401_10777921F076161LKSINFSSRYPKTGFRAFAEKPVVKSLLLPQFGGQKMPPQGASIPNRLTAWTVPQIATDPKERSNLLSSPTNPDAPTGKPI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.