3300008946: T18 (3) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times DE NOVO (2)

Overview

Basic Information

• IMG/M Taxon OID: 3300008946
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0117429 | Gp0123961 | Ga0115989
• Sample Name: T18 (3) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times DE NOVO (2)
• Sequencing Status: Permanent Draft
• Sequencing Center: Shell Corporation
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 135231309
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin060	1
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater river biome → river → sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Sediment (non-saline)

Location Information

• Location: UK (Newcastle upon Tyne)
• Coordinates
  • Lat. (^o): 54.971158
  • Long. (^o): -1.703654
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050029	Metagenome / Metatranscriptome	146	Y
F073228	Metagenome / Metatranscriptome	120	N
F090409	Metagenome	108	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0115989_1002310	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin060	2219
Ga0115989_1018541	Not Available	662
Ga0115989_1072037	Not Available	500

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0115989_1002310	Ga0115989_10023103	F090409	VKKEFAGILQTSFGMMGSVHFSLEMPGSLIGDANQFLEGARRKRVLVTIETQEVAD*
Ga0115989_1018541	Ga0115989_10185412	F050029	MIRTRGENMATIVIHWKDKEIPPMELKAAAYKGADSSIINITSNGKDYWFNWSECWYLETTSTE*
Ga0115989_1072037	Ga0115989_10720371	F073228	LVEGVEGIDMAITIGDIMDINSSKYGEFLYKIVMVFPHNMEVDKTELARLIKISNNTLTFERKNGEKFTLDERDIEHMDLFRSPNYKGGI*