NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008698

3300008698: Microbial communities of saline water collected from the North Sea in Germany - HE327_3b



Overview

Basic Information
IMG/M Taxon OID3300008698 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117953 | Gp0126208 | Ga0103619
Sample NameMicrobial communities of saline water collected from the North Sea in Germany - HE327_3b
Sequencing StatusPermanent Draft
Sequencing CenterGoettingen Genomics Laboratory
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size8339242
Sequencing Scaffolds9
Novel Protein Genes10
Associated Families10

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Predicted Viral2
Not Available2
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities Of Saline Water Collected From The North Sea In Germany
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → North Sea → Microbial Communities Of Saline Water Collected From The North Sea In Germany

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationNorth Sea, Germany
CoordinatesLat. (o)54.4223Long. (o)7.6833Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000049Metagenome / Metatranscriptome3277Y
F000481Metagenome / Metatranscriptome1089Y
F003081Metagenome / Metatranscriptome508Y
F007123Metagenome / Metatranscriptome357Y
F012347Metagenome / Metatranscriptome281N
F017650Metagenome / Metatranscriptome239N
F047922Metagenome / Metatranscriptome149Y
F049593Metagenome / Metatranscriptome146N
F060355Metagenome / Metatranscriptome133Y
F103310Metagenome / Metatranscriptome101N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103619_100206All Organisms → Viruses → Predicted Viral1437Open in IMG/M
Ga0103619_100289Not Available1246Open in IMG/M
Ga0103619_100294All Organisms → Viruses → Predicted Viral1234Open in IMG/M
Ga0103619_100503All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1004Open in IMG/M
Ga0103619_100723All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon839Open in IMG/M
Ga0103619_100766Not Available814Open in IMG/M
Ga0103619_101625All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae564Open in IMG/M
Ga0103619_101685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
Ga0103619_102046All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda507Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103619_100206Ga0103619_1002061F007123FAASMQEFGKSDVDGEFASSSDKLDSLVKSYMDDNQLKKSEYAKAYAVVAKTDEGKSLINKTYKGE*
Ga0103619_100289Ga0103619_1002891F012347MNRIKHGNVNKWTSTKAGQVIEFASSKPRHVKFEITANSNIEIWVADNNKMSDAVLVGTSNGKTEIQYTAVATTYVQIKAEKSADVFVNIPDLDQAVENTDNPSFTSIEPRVNNSTEFDRMMTFMKHNEQQRNAQLEAERAALRAEVAKIKAEAETVVEAPVEAETEDAGETPE*
Ga0103619_100294Ga0103619_1002943F047922MTPQEIVAHKNKWRMASYFVSHTHSDLRSEATQWCKDHCFQWRYDIKHFTDIYGDTVRFELEEDFNAFNEWYQERMYG*
Ga0103619_100503Ga0103619_1005031F003081MPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTIFVLSYLHILKKIYLKNYVSAESDG*
Ga0103619_100723Ga0103619_1007233F060355MKIKDDILEKWEQGWTIYDIAEYWNTPVENIMKILGIQENPFSYELH*
Ga0103619_100766Ga0103619_1007663F049593MDKELQQYYETLLDLFSSQGWKQYVEDISDNMDLLQDITTIPDEKQFWFRRGQIEALQRVLSYESAIKNSYEDFEKEQYA*
Ga0103619_101625Ga0103619_1016251F103310GEAGSLLIGLLDAGGLLVALEFDMAVGGKVGRNSTMGSVSASSSGDGSLADGMVDNASLDIESFLLSVGLKVLEEGLNSLDGLLGPSSKLVLEDLALGVTADTTGVHSERNDGFFSEASVHVLDGLVNFKTLACAGNIVRVLVMDSQVTDLTDGGFSGLSGLSGVLYHCKLIPIY*
Ga0103619_101685Ga0103619_1016851F017650INLKTMKFFALALAATVSAVTIRGDFFEARDNGTGPLDKKYERVLPVQFADSSDDLFMRSMIMNYAREGKNEDGSPNGVFTMTEAQTRGASAEVLSTHKKMSAAETKEYLQTYFPRTWAHFDVNRSGSVEVIKMPQVMRFLASDQQMYLW*
Ga0103619_101994Ga0103619_1019941F000049MTFWQENYTFIKDVYDMRHQKMAEWMENVEKAIARIMADKVYTSAEFKRERDNFHALCKDLERAEVKKWLAQILEILMAERAKDQRKKESDLLDALILKHEELIPTVTKTQVMVDLYWKCYAYGDELKPHIEFLDGIMMSSTREIAP
Ga0103619_102046Ga0103619_1020461F000481KPHIEFLDGIMMSSTRDIAPSCVENVDELIERQEKSLNQLETKRGIVKDLIEKGKKIMENPDKPRFLESHVTHIEEGWEDTRNKASDRLRLLQETKDAWVGYAEDNETIATMFEKAEDEMKKIKKRYNLQAAMDDLKKRQDIFKKDNDKITGLFDAIQNKHYKCMCIT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.