3300008433: Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 159753524 reassembly

Overview

Basic Information

• IMG/M Taxon OID: 3300008433
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0063646 | Gp0053289 | Ga0115379
• Sample Name: Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 159753524 reassembly
• Sequencing Status: Permanent Draft
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 22139089
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Location: National Institutes of Health, USA
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004001	Metagenome	457	Y
F063778	Metagenome	129	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0115379_101745	All Organisms → cellular organisms → Bacteria	2167
Ga0115379_106106	Not Available	556

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0115379_101745	Ga0115379_1017452	F063778	MPETISEGAKQQLLQQLQNALGLVADADTSAHDVAAITQSAADGHQLTEVMLQQMTAIEAYLKNCQTSINDAIDNIEAIPLDPPPED*
Ga0115379_106106	Ga0115379_1061062	F004001	VESPSLEVFKNHGDVALRDVVSGHGGDGLVVGLGDLSGLFQP*