Basic Information | |
---|---|
IMG/M Taxon OID | 3300008361 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0053222 | Ga0115082 |
Sample Name | Human stool microbial communities from NIH, USA - visit 1, subject 764325968 reassembly |
Sequencing Status | Permanent Draft |
Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 126719161 |
Sequencing Scaffolds | 4 |
Novel Protein Genes | 4 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → unclassified Lachnospiraceae → Lachnospiraceae bacterium 8_1_57FAA | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Oscillibacter → Oscillibacter valericigenes | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | National Institutes of Health, USA | |||||||
Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F026592 | Metagenome / Metatranscriptome | 197 | Y |
F055775 | Metagenome | 138 | N |
F081354 | Metagenome | 114 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0115082_100526 | Not Available | 41097 | Open in IMG/M |
Ga0115082_104632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → unclassified Lachnospiraceae → Lachnospiraceae bacterium 8_1_57FAA | 3867 | Open in IMG/M |
Ga0115082_117617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Oscillibacter → Oscillibacter valericigenes | 756 | Open in IMG/M |
Ga0115082_118856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 702 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0115082_100526 | Ga0115082_10052628 | F055775 | MAQIAQQDNLVIEVAKSTATLDGDTKKKLIECIKGGTITDVILVTKEAEKKISHARVVSWLVDTTGNSPKYKIDIINVNSGNVEGIALN* |
Ga0115082_104632 | Ga0115082_1046321 | F026592 | TASPQGIAALAAQGGVATLTERSDATFSVGQFSSADRE* |
Ga0115082_117617 | Ga0115082_1176171 | F026592 | QNRLRTASPQGIAALAAQGGVATLTERSDETFSVGQFSSADWE* |
Ga0115082_118856 | Ga0115082_1188561 | F081354 | SAHIFVKDFSSIFPKSGCRSPLKKGAATENPLEYGKTEVQILFEPLQATISSMELPKNFENKKLPNPFCFPS* |
⦗Top⦘ |