x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300008336
3300008336: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 638754422 reassembly
Overview
Basic Information
IMG/M Taxon OID 3300008336 Open in IMG/M
GOLD Reference (Study | Sequencing Project | Analysis Project) Gs0063646 | Gp0053248 | Ga0115198
Sample Name Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 638754422 reassembly
Sequencing Status Permanent Draft
Sequencing Center Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published? N
Use Policy Open
Dataset Contents
Total Genome Size 27935327
Sequencing Scaffolds 1
Novel Protein Genes 1
Associated Families 1
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
Type Host-Associated
Taxonomy Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified
Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal surface
Location Information
Location National Institutes of Health, USA
Coordinates Lat. (o ) N/A Long. (o ) N/A Alt. (m) N/A Depth (m) N/A
Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F067847 Metagenome 125 N
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0115198_105571 All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes 839 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0115198_105571 Ga0115198_1055711 F067847 MFSHIIRVRGIFDDEPTTKKLYFHMSRREMFDFIKRYDNVTNFEKWLQAAIDNEDLYTMMKFFDDLIGTSYGERQGERFVKSEQIKESFLNSPEYEELFDQLMDNPSLVREFYNGILPEKIMKQVQQDPKYKELDNKLKETELKNL*