Basic Information | |
---|---|
IMG/M Taxon OID | 3300007278 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063646 | Gp0052682 | Ga0104339 |
Sample Name | Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 160319967 reassembly |
Sequencing Status | Permanent Draft |
Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 28502277 |
Sequencing Scaffolds | 6 |
Novel Protein Genes | 6 |
Associated Families | 6 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 279 | 1 |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas | 1 |
Not Available | 1 |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 1 |
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Primates → Haplorrhini → Simiiformes → Catarrhini → Hominoidea → Hominidae → Homininae → Pan | 1 |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Maryland: Natonal Institute of Health | |||||||
Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F045567 | Metagenome | 152 | N |
F055792 | Metagenome | 138 | N |
F073671 | Metagenome | 120 | N |
F077781 | Metagenome / Metatranscriptome | 117 | N |
F094006 | Metagenome | 106 | Y |
F098763 | Metagenome | 103 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0104339_100934 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → unclassified Porphyromonas → Porphyromonas sp. oral taxon 279 | 2524 | Open in IMG/M |
Ga0104339_101582 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas | 1663 | Open in IMG/M |
Ga0104339_103119 | Not Available | 1045 | Open in IMG/M |
Ga0104339_104482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae | 847 | Open in IMG/M |
Ga0104339_107738 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Primates → Haplorrhini → Simiiformes → Catarrhini → Hominoidea → Hominidae → Homininae → Pan | 632 | Open in IMG/M |
Ga0104339_108895 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae | 586 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0104339_100934 | Ga0104339_1009343 | F045567 | MRQRDGRDTLTEELEGGIIPLLYRAEGEARRPWVRMVTEDVVHTSTHRVKDALLPVDGDILTPRDGTHIVQTERVVVVLVSQEDSIDTIDTETCGLVVEVRATVDEDTLPTLGDDEGRGAQTTVTSIRAMAHRAATAYLGDTSAGARTEKNYLHVSRRESYHG* |
Ga0104339_101582 | Ga0104339_1015822 | F098763 | MDRRTSLRILSTALYLATKLFEAVVRATISYDPSDEVEGKGGMNAIPTAVDE* |
Ga0104339_103119 | Ga0104339_1031192 | F055792 | VEIASEALDSTSAVTHRILFLTTQLGESLLTSLGTEDGVIAEAMVTRALESNLSIDSTLEEVGPVLIDKGDDGTEASTTWGRYTLETLQKEGYILFEGSMLPCEARRVDSRSSVKSLNLEPRIIGEAIEPVALPDVTRLDESIALQGIGSLRDLLMTPDVSETDHLQTSREEGTDLLQLMGIIARKYQLFHTFVS* |
Ga0104339_104482 | Ga0104339_1044821 | F073671 | MNKEQAKHELAELHEKERSLEKALELVREKIRELVNCTDKNKV* |
Ga0104339_107738 | Ga0104339_1077381 | F077781 | PPPIAAPARPAPAHLKAPAAVTGGWGSPRQNDFFILLTLESPAPCDPLQTESHLVFRTRIHSQVQWGDVRGVAGRTKDSLPSDSVCTVGPRAGALSVRTADSLCLGFPRPHPGTPGLGRFWPFLALQSLSETPSHARMPRVTVARTSPETLEISPLRAAT* |
Ga0104339_108895 | Ga0104339_1088951 | F094006 | LEPADPTGTLYESAVCVEAHIGELQAGGIARRGLFAFGRRDLLAVAELGAEAPYAIDMYDIAVCEPLSELFAKELEYAFNFGA* |
⦗Top⦘ |