NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300007108

3300007108: Human stool microbial communities from NIH, USA - visit 1, subject 160421117



Overview

Basic Information
IMG/M Taxon OID3300007108 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052638 | Ga0102731
Sample NameHuman stool microbial communities from NIH, USA - visit 1, subject 160421117
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size70538577
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026592Metagenome / Metatranscriptome197Y
F029444Metagenome188Y
F067720Metagenome125Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0102731_100139All Organisms → cellular organisms → Bacteria56895Open in IMG/M
Ga0102731_100529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales24093Open in IMG/M
Ga0102731_108826All Organisms → cellular organisms → Bacteria1043Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0102731_100139Ga0102731_10013911F067720MSSTTYEHFVDTNKMYAAQEQFRGITKMVTKCHRFAVLGNMVRNAGQLPQPFWLGTACGGGSHSLSAGVARA*
Ga0102731_100529Ga0102731_10052924F029444MDVSEQLTGFELEDLMSWTVSNLQRPFREDFSLQKSGIIAEKGLQIFGCRFVGFDRPKKRRPFSISKRALAAASETAGRGR
Ga0102731_108826Ga0102731_1088263F026592NSILCCLRTASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.