NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006888

3300006888: Combined Assembly of Gp0125122, Gp0125123, Gp0125658



Overview

Basic Information
IMG/M Taxon OID3300006888 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117429 | Gp0125122 | Ga0102492
Sample NameCombined Assembly of Gp0125122, Gp0125123, Gp0125658
Sequencing StatusPermanent Draft
Sequencing CenterShell Corporation
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size86542815
Sequencing Scaffolds9
Novel Protein Genes12
Associated Families9

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2
All Organisms → cellular organisms → Archaea2
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium1
Not Available1
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.1
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSyntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUK (Newcastle upon Tyne)
CoordinatesLat. (o)54.971158Long. (o)-1.703654Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020363Metagenome / Metatranscriptome224Y
F030486Metagenome / Metatranscriptome185Y
F040697Metagenome / Metatranscriptome161Y
F064732Metagenome / Metatranscriptome128Y
F064746Metagenome / Metatranscriptome128N
F074913Metagenome / Metatranscriptome119Y
F092111Metagenome / Metatranscriptome107Y
F101218Metagenome / Metatranscriptome102Y
F106197Metagenome / Metatranscriptome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0102492_104650All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2295Open in IMG/M
Ga0102492_104883All Organisms → cellular organisms → Archaea2205Open in IMG/M
Ga0102492_106272All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium1809Open in IMG/M
Ga0102492_117273Not Available890Open in IMG/M
Ga0102492_122291All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.759Open in IMG/M
Ga0102492_123470All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112735Open in IMG/M
Ga0102492_123983All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae725Open in IMG/M
Ga0102492_130241All Organisms → cellular organisms → Archaea631Open in IMG/M
Ga0102492_142024All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes517Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0102492_104650Ga0102492_1046502F020363MWRWRRVAVARVFALVVRCRDMILFVYSRVGKNRDTRRESPAGAGAGRTADHLTVLFSQKFLAVRKANDIYRPVMLRFLTCLYCSKL*
Ga0102492_104883Ga0102492_1048832F064732MEAAAEAALAAAPERCTMPPAQSAERHVKFPSSPMDPGPYIAAIATRSTSQQDPVPPGHPEDTNYLIVI*
Ga0102492_104883Ga0102492_1048833F040697LKETVIAMKLIEKLVDDNVMDDILKEAADGYGDLIAAALVHKVSVKSLQTRVTQLRDLRAAWIS*
Ga0102492_106272Ga0102492_1062721F030486PNVRRYVALPQSRGGACFCTRGAVQDYAVNSLFSRWQKP*
Ga0102492_117273Ga0102492_1172731F074913MLNLTFGGMWRWRRVAVARVFALVVRCRVMMLFLYSRVGKNRDTRRGYPAGAGAACAANHKMVLFSQKTLAAQKPMTYTDLLGQVVVY*
Ga0102492_119451Ga0102492_1194512F020363ALTFGGMWRWRRVAVARVFALVVRCGIMMLFVYSRVGKNRDTSRESPAGAGAGRTADHLAILFSQKVLAVRKANCISRPFMHRNYYLLFAVSVKHEILLKSPA*
Ga0102492_122291Ga0102492_1222912F092111MTPEEEGSDVREMVWEMSRTTNKILIFGIILILAILAVLM
Ga0102492_123470Ga0102492_1234702F106197VAAGVLAEVGFALGCYLFIQPFSTKCVSPILCISVDSVSADTISAQIDSFDFLSGDWYCGSNQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPESVYAEPGDSTYFVSPVWNIPDDAELGEYQADFYLYGYYDSRTGELSEQLDQVDQVRAFSVVG*
Ga0102492_123983Ga0102492_1239832F020363LPLLALTFGGMWRWRRVAVARVFALVVRSRIKRLLLYSRVGKNRDTLRESPARAGAGRTADHLSVLFSQKVLAVRKSQ*
Ga0102492_126049Ga0102492_1260491F064746MNKIIWIALILLLGVFAIGGMSGTSGNDDAKNVTIDGYTFEGDFDNKWISGYGDTKTYKPANLEDQFGIPIGAYDWTGTENYNAFYYESGEPSGSITKYGWANIFVLKPDEDMANVLKSATRLLINPRDHRNAVVAGDLTEKYIEYN
Ga0102492_130241Ga0102492_1302412F101218MSKQGPKPALPRVKEPPPLPSLGELIAESRALGWDDLAGSMEKLRHLETPEGQKALERREKRLSRL*
Ga0102492_142024Ga0102492_1420242F030486PITIMLAAIVTNVRRYVALAQSRGGARFCTRGEMQDYATITLFLRWQKP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.