3300006873: T14 (3) BES, Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times

Overview

Basic Information

• IMG/M Taxon OID: 3300006873
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0117429 | Gp0125658 | Ga0102490
• Sample Name: T14 (3) BES, Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times
• Sequencing Status: Permanent Draft
• Sequencing Center: Shell Corporation
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 33752351
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater river biome → river → sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Sediment (non-saline)

Location Information

• Location: UK (Newcastle upon Tyne)
• Coordinates
  • Lat. (^o): 54.971158
  • Long. (^o): -1.703654
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040697	Metagenome / Metatranscriptome	161	Y
F074913	Metagenome / Metatranscriptome	119	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0102490_110889	Not Available	697
Ga0102490_112742	All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon	628

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0102490_110889	Ga0102490_1108891	F074913	LTFGGMCSWRRVAVARVFALVVRCRDMMLFVYSRVGKNRDTRRESPAGAGAGRTANHLTVLFSQKILAGGEPIAYTDLLGAGNLCSHL*
Ga0102490_112742	Ga0102490_1127422	F040697	MKLIEKLVDDNVMDDILKEAADGYGDLIAEALVHKVSVKSLQKRVVQLRDLRVTWIS*