NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006685

3300006685: Metatranscriptome of deep ocean microbial communities from South Indian Ocean - MP1371 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300006685 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053074 | Gp0092424 | Ga0031690
Sample NameMetatranscriptome of deep ocean microbial communities from South Indian Ocean - MP1371 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size40785719
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Flabellinia → Vannellidae → Vannella → Vannella robusta1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Saccharomycotina → Saccharomycetes → Saccharomycetales → Debaryomycetaceae → Meyerozyma → Meyerozyma guilliermondii1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Ocean Microbial Communities From The Global Malaspina Expedition
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationSouth of Port of Lincoln, Great Australian Bight, South Indian Ocean
CoordinatesLat. (o)-39.24Long. (o)135.14Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F061786Metagenome / Metatranscriptome131Y
F063613Metatranscriptome129N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0031690_1104802All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Flabellinia → Vannellidae → Vannella → Vannella robusta676Open in IMG/M
Ga0031690_1105646All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Saccharomycotina → Saccharomycetes → Saccharomycetales → Debaryomycetaceae → Meyerozyma → Meyerozyma guilliermondii606Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0031690_1104802Ga0031690_11048021F061786GANNTKGLYLCETIYPPDNGMSCIPPEKLEKAIKKGEIPPQVQADEEDLDGNMDEVIDNCIREVWQYYDPKGVGFLNKKQTQTFFKDALNLVALRKNCKSKDLFQGRKEGAALEEAFRQVNTSGDGRVTFEQFEEFINAYDLDEAVDFLTGGNSEHQINTQGVQMVDNSSLPSGGGPVKGKIEYRDYGALED*
Ga0031690_1105646Ga0031690_11056461F063613MNLITSLLKKRGGERGSGLLVGLALKGSGGLLALVVGGSTNLSLLLQSLDGILILPSDLVGQTTEASEVAARSESQHTEGLRANHTVDLVVRRGDTLEDLEVSQSGGTTGGLVGDHSTDGSPENLRGSTEVERTTSGVDVASLSKEVLVLELVSEVRTRDVDVLATNNNDLLSGQELLGNSGGKTAQKVTLSVNHDSLLKHA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.