NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006651

3300006651: T8 (1) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times



Overview

Basic Information
IMG/M Taxon OID3300006651 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117429 | Gp0125097 | Ga0101725
Sample NameT8 (1) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times
Sequencing StatusPermanent Draft
Sequencing CenterShell Corporation
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size56267129
Sequencing Scaffolds7
Novel Protein Genes7
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → Alkaliflexus → Alkaliflexus imshenetskii1
Not Available1
All Organisms → cellular organisms → Archaea1
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.2
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSyntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater river biomeriversediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUK (Newcastle upon Tyne)
CoordinatesLat. (o)54.971158Long. (o)-1.703654Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030405Metagenome / Metatranscriptome185Y
F040697Metagenome / Metatranscriptome161Y
F047387Metagenome / Metatranscriptome150Y
F048390Metagenome / Metatranscriptome148Y
F091072Metagenome / Metatranscriptome108Y
F092111Metagenome / Metatranscriptome107Y
F102132Metagenome102Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0101725_112888All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → Alkaliflexus → Alkaliflexus imshenetskii870Open in IMG/M
Ga0101725_113424Not Available848Open in IMG/M
Ga0101725_116763All Organisms → cellular organisms → Archaea738Open in IMG/M
Ga0101725_119853All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.661Open in IMG/M
Ga0101725_124774All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.574Open in IMG/M
Ga0101725_126065All Organisms → cellular organisms → Bacteria554Open in IMG/M
Ga0101725_129263All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112512Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0101725_112888Ga0101725_1128881F030405FCTRGAMQGYDGYFFILALAKTVTPGGSPRREPGRPAPRW*
Ga0101725_113424Ga0101725_1134242F048390MVRFVRTLQHRVTPKGRDFYALSIPPQVAEALNLKAGGAVSICVNPVKKGKFEITLKPASCDNINP*
Ga0101725_116763Ga0101725_1167632F047387MAAEISREVIILDEEYADAEYRRFLREEDKYMDFDEFCCQEGI*
Ga0101725_119853Ga0101725_1198532F040697VIAMKLIEKLVDDNVMDDILKEAADGYGDLIAAALVHKVSVKCLQTRVTQLRDLRAAWIS
Ga0101725_124774Ga0101725_1247741F092111VTPEEEGSDVREMVWEMSRTTNKILIFGIILILAILAVLMYCGI
Ga0101725_126065Ga0101725_1260652F102132MNTQTVVKNLESAINRICKDIKDKKGGSGADKLDSLAKLVNAYSRLIERDKEKEKDYDPMEDGDPNYYKKLEANNKDRRGIIR
Ga0101725_129263Ga0101725_1292632F091072MAGTMKETAMPVRGETDEEIKALLKGTDVAWTQYKRDHGTRVTS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.