NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006611

3300006611: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS903_Marker113_DNA



Overview

Basic Information
IMG/M Taxon OID3300006611 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0111355 | Gp0107627 | Ga0101553
Sample NameDiffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS903_Marker113_DNA
Sequencing StatusPermanent Draft
Sequencing Center
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size193269043
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium1
Not Available3
All Organisms → cellular organisms → Archaea → Euryarchaeota1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDiffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine hydrothermal vent biomemarine hydrothermal venthydrothermal fluid
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationAxial seamount, northeast pacific ocean
CoordinatesLat. (o)45.92274Long. (o)-129.988104Alt. (m)N/ADepth (m)1522
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005684Metagenome / Metatranscriptome393Y
F018078Metagenome / Metatranscriptome237Y
F033215Metagenome / Metatranscriptome178Y
F062154Metagenome / Metatranscriptome131N
F072444Metagenome121N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0101553_1096766All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium555Open in IMG/M
Ga0101553_1122450Not Available864Open in IMG/M
Ga0101553_1163001All Organisms → cellular organisms → Archaea → Euryarchaeota1152Open in IMG/M
Ga0101553_1173004Not Available500Open in IMG/M
Ga0101553_1293231Not Available587Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0101553_1096766Ga0101553_10967661F062154VGANGVKVLSVVNARPEQPVNSVANGVKVLSVVNARPEQPVNSVVNARPERLVNRVVNGVRAPSVVNVRPEQAVSVDRSPGAVVVGEDQVVLCGCSL*
Ga0101553_1122450Ga0101553_11224503F018078QSILKFEKFLVWQLHNRTEIVIAIVAFVIGAILF*
Ga0101553_1163001Ga0101553_11630013F005684VYDTEESPLSLMQVVRRKSEVREGRLCNRNEPRQAHCEPERGRFPDRGWNEHPHRSKSKQVRM
Ga0101553_1173004Ga0101553_11730041F033215PPVEERVPAVALIPPLRDKSASPVSIFSPAASRVTGCAMLSLDILSSSVKAKLANSSVPTDREALSSIVEFAAKRRVVELSGSTPLKSTPSTSRILLLLSDRAFAFVVNVVPFVFRVAPVSDKAFSSTNVVPGIEILVPDGALAPETRVIVPPEEFSDALSVNANA
Ga0101553_1293231Ga0101553_12932313F072444MPERENNAFWEIAELIEREMSILRKMRPVGPKEKALLKKMMDDKKKEYEKRTNSPKITRFGSSLT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.