NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006475

3300006475: Human buccal mucosa microbial communities from NIH, USA - visit 2 of subject 158883629



Overview

Basic Information
IMG/M Taxon OID3300006475 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052508 | Ga0100234
Sample NameHuman buccal mucosa microbial communities from NIH, USA - visit 2 of subject 158883629
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size21424045
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Neisseria1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Primates → Haplorrhini → Simiiformes → Catarrhini → Hominoidea → Hominidae → Homininae → Pan1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F077405Metagenome117N
F077781Metagenome / Metatranscriptome117N
F101360Metagenome102N
F103431Metagenome101N
F103434Metagenome101N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0100234_100208All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes7052Open in IMG/M
Ga0100234_100358All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes4750Open in IMG/M
Ga0100234_101021All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae2170Open in IMG/M
Ga0100234_104662All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Neisseria718Open in IMG/M
Ga0100234_105002All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Primates → Haplorrhini → Simiiformes → Catarrhini → Hominoidea → Hominidae → Homininae → Pan689Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0100234_100208Ga0100234_1002083F103434VVGFRPRRGRYLENGPHVVEVTLAVVKEGRTGRRFERGETFVVDKVLVQPSAGNALKATENRVIRGDLTDETTLKVFGTGRKWPGGPHSWVKIIKGPESLVGKTFQQAGEPLTYDASPMTRHWSVRCDTLGTESR*
Ga0100234_100358Ga0100234_1003582F101360VSKESALRRAAIAAHIAKVASQEKKKALKELEEYMAPGDTSKPQDDGLQVGTVSVSAPQPRYQVVDENALVTWLEWNKPDAVHKVPAPWFVATAALEGFIKQTGEVPDGVEVVQGDPRISVRVSGAQEEAIRELISTGDISLIEIEGGDA*
Ga0100234_101021Ga0100234_1010214F077405SNSRPRPWQGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKNFFDWLKIIQK*
Ga0100234_104662Ga0100234_1046623F103431MINLDGLIVGMLFFIQLFLQSIAWGVAIAHFLHAERGNAAAAAFDGAFGENIADCHAEDDNDKNAESQKEGFHVCIPEG*
Ga0100234_105002Ga0100234_1050021F077781PIAAPARPASAHLKAPAAVTGGWGSPRQNDFFILLTLESPAPCDPLQTESHLVFRTRIHSQVQWGDVRGVAGRTKDSLPSDSVCTVGPRAGALSVRTADSLYLGFPRPHPGTPGLGRFWNFLALQSLSETPSHARMPRVTVARTSPETLEISPLRAAT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.