NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006361

3300006361: Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S5 AAIW_A metaT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300006361 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114292 | Gp0119664 | Ga0079055
Sample NameSeawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S5 AAIW_A metaT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size13486745
Sequencing Scaffolds3
Novel Protein Genes4
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Eukaryota → Opisthokonta1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationAtlantic Ocean
CoordinatesLat. (o)-28.2362Long. (o)-38.4949Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056191Metagenome / Metatranscriptome138Y
F060086Metagenome / Metatranscriptome133Y
F103410Metagenome / Metatranscriptome101N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0079055_103443Not Available1151Open in IMG/M
Ga0079055_110137All Organisms → cellular organisms → Eukaryota → Opisthokonta1421Open in IMG/M
Ga0079055_111804Not Available587Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0079055_100275Ga0079055_1002751F103410PSTFRHVVRRPVFELSLKNPWPKACCSRSLVVKKCRPKGLQSLIASLPGLSHKSPQTRRSTTTCILAQPTPTRPRASPFGALISVPAQHVLRRTPEGTSRTVLTDQIGLPKVSRPPQRRTFLHHPEASLEHASFRLPYYKTAQRLFSNTADHFCQHLRRHARVPDPGPTHRHSDDPKITFLPISLAFDRLARGPHGPGHTTPEGFACRFGCSTAPLLPGGIATTVSQPSHSTQKPLGHSTLCRTIRP*
Ga0079055_103443Ga0079055_1034433F060086MIIRTTAGQEDPFELDSSLLLSSGRHGEDSKRQYSIKLLYEHETPLLDDLAD*
Ga0079055_110137Ga0079055_1101371F056191HALTAEMSKTFPSGGSMHARVKLEGIDGRAPQERGACGLI*
Ga0079055_111804Ga0079055_1118041F056191MCNARVRHALTAEMSKTFPSGGSMHARVKLEGIDGRAPQERGACGLI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.