Basic Information | |
---|---|
IMG/M Taxon OID | 3300006361 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114292 | Gp0119664 | Ga0079055 |
Sample Name | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S5 AAIW_A metaT (Metagenome Metatranscriptome) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 13486745 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 4 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 2 |
All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine biome → marine water body → sea water |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Atlantic Ocean | |||||||
Coordinates | Lat. (o) | -28.2362 | Long. (o) | -38.4949 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F056191 | Metagenome / Metatranscriptome | 138 | Y |
F060086 | Metagenome / Metatranscriptome | 133 | Y |
F103410 | Metagenome / Metatranscriptome | 101 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0079055_103443 | Not Available | 1151 | Open in IMG/M |
Ga0079055_110137 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1421 | Open in IMG/M |
Ga0079055_111804 | Not Available | 587 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0079055_100275 | Ga0079055_1002751 | F103410 | PSTFRHVVRRPVFELSLKNPWPKACCSRSLVVKKCRPKGLQSLIASLPGLSHKSPQTRRSTTTCILAQPTPTRPRASPFGALISVPAQHVLRRTPEGTSRTVLTDQIGLPKVSRPPQRRTFLHHPEASLEHASFRLPYYKTAQRLFSNTADHFCQHLRRHARVPDPGPTHRHSDDPKITFLPISLAFDRLARGPHGPGHTTPEGFACRFGCSTAPLLPGGIATTVSQPSHSTQKPLGHSTLCRTIRP* |
Ga0079055_103443 | Ga0079055_1034433 | F060086 | MIIRTTAGQEDPFELDSSLLLSSGRHGEDSKRQYSIKLLYEHETPLLDDLAD* |
Ga0079055_110137 | Ga0079055_1101371 | F056191 | HALTAEMSKTFPSGGSMHARVKLEGIDGRAPQERGACGLI* |
Ga0079055_111804 | Ga0079055_1118041 | F056191 | MCNARVRHALTAEMSKTFPSGGSMHARVKLEGIDGRAPQERGACGLI |
⦗Top⦘ |