3300005572: Marine microbial communities from the Deep Atlantic Ocean - MP0139 (Metagenome Metatranscriptome)

Overview

Basic Information

• IMG/M Taxon OID: 3300005572
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053074 | Gp0054875 | Ga0005500
• Sample Name: Marine microbial communities from the Deep Atlantic Ocean - MP0139 (Metagenome Metatranscriptome)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 63352589
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Deep Ocean Microbial Communities From The Global Malaspina Expedition
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Atlantic Ocean
• Coordinates
  • Lat. (^o): 14.311
  • Long. (^o): -26.0
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013050	Metagenome / Metatranscriptome	275	Y
F103104	Metagenome / Metatranscriptome	101	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0005500_1043217	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1980
Ga0005500_1159293	Not Available	650

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0005500_1043217	Ga0005500_10432173	F013050	MSKGKQPRTRVKVPKLLLSETKEVFFKYNQEIGLEAAIF*
Ga0005500_1159293	Ga0005500_11592931	F103104	FGIPSGCPSTNLVFTKSITLPKDSVVYATGHIITKQKGGRADLYLKINNGMRDYALSEDSTGQWVDLTVNHATTLKKGKYTFQISSNKNARFGCGAGWGDLDIVVVPKFKGVAAYNQPDTKSGCPAKRAANTDLILKTIKVDQTSIIKVTGHIIRTFSGRADAYLKYQRKTNLDTSLTYTNNRRWEDVKLHWTGRLGKGTHTFSIQSNKANAFGCG