NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300005379

3300005379: Marine microbial communities from Deepwater Horizon subsurface plume in Gulf of Mexico, 16-4 Below Plume



Overview

Basic Information
IMG/M Taxon OID3300005379 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0047147 | Gp0052343 | Ga0074271
Sample NameMarine microbial communities from Deepwater Horizon subsurface plume in Gulf of Mexico, 16-4 Below Plume
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size52440998
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha1_Bin12

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From Deepwater Horizon Subsurface Plume In Gulf Of Mexico
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Subsurface Plume → Marine Microbial Communities From Deepwater Horizon Subsurface Plume In Gulf Of Mexico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine black smoker biomeblack smokersea water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationGulf of Mexico
CoordinatesLat. (o)28.716667Long. (o)-88.466667Alt. (m)N/ADepth (m)1250
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002556Metagenome / Metatranscriptome548Y
F076161Metagenome / Metatranscriptome118N
F077438Metagenome / Metatranscriptome117Y
F098669Metagenome / Metatranscriptome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0074271_108817Not Available974Open in IMG/M
Ga0074271_125185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha1_Bin1919Open in IMG/M
Ga0074271_134073All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha1_Bin1938Open in IMG/M
Ga0074271_148257Not Available509Open in IMG/M
Ga0074271_170949Not Available506Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0074271_108817Ga0074271_1088173F077438THRVERPFAQSRFETLFLWSLQVEISSDLMPTVEKEISSNKN*
Ga0074271_125185Ga0074271_1251851F076161EAHRFMKSINFSSRCPKTGFRAFAEKPVAKSLLLPQFGGQKMPPQGASIPNLLTAWTVPQTAADPKEHSNLLSSPTNPDAPTGKPI*
Ga0074271_134073Ga0074271_1340733F076161RVRRQVHWTRGPSNVSRRIRLTPRNRRAEAHRFMKSINFSSRCPKTGFRAFAEKPVAKSLLLPQFGGQKMPPQGASIPNRLTAWTVPQIAADPKERSNLLSSPTNPDAPTGKPV*
Ga0074271_148257Ga0074271_1482571F002556LDLRQGPPRAWIGLEQFVNWATDHLITKVATIDAKSEVDFYHVEQYGEHQTLVFLEQAVTDPNSRAHASLYEFLLAIFTEVDSRSTGVLTFGEFDTLLSRAAEVPRTFGLAPPDASKEVRKQFFDSMNDAQMGGVTFRTLLAWTVEHAKGKIEAQKVGKGYKK*
Ga0074271_170949Ga0074271_1709491F098669METATRSRKQKWRLKEAEGLGRKRRVEEAERRELHESDQGLDPGHGLNPGRKVRRIDQAMEGSPEIVPAKIRKKP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.