Basic Information | |
---|---|
IMG/M Taxon OID | 3300005372 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0056601 | Gp0051600 | Ga0074246 |
Sample Name | Marine bacterioplankton communities from Palmer Station B, Arthur Harbor, Antarctica - Winter Sample 10334 |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 1933492 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2 |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Marine Bacterioplankton Communities From Palmer Station B, Arthur Harbor, Antarctica |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Marine Bacterioplankton Communities From Palmer Station B, Arthur Harbor, Antarctica |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine biome → marine neritic zone → sea water |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Late winter and summer Antarctic waters | |||||||
Coordinates | Lat. (o) | -64.067 | Long. (o) | -64.767 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004613 | Metagenome / Metatranscriptome | 431 | Y |
F013024 | Metagenome / Metatranscriptome | 275 | N |
F016456 | Metagenome / Metatranscriptome | 247 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0074246_103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 14893 | Open in IMG/M |
Ga0074246_141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 44278 | Open in IMG/M |
Ga0074246_145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 37525 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0074246_103 | Ga0074246_10317 | F016456 | MPRKPNYKDLLKKFKKRNIKNPERIATAYVKGLTAGSKKKAAKNLTGIID* |
Ga0074246_141 | Ga0074246_14133 | F013024 | MYEIKKDKLSKDFLTKKLFWLGIIGTYIIAGVMLNKLENNADYDDLILISIIPSSYYFFMLFLSYKSFKDEAIRTTILQFTIQILLLLPLMSMYMAVLLFSTKIS* |
Ga0074246_145 | Ga0074246_14521 | F004613 | MIPNVTKKLNLSAEDLKRQKNIISKLNLAKLPFDISPDRMCALNLEMARHSSAVLKYQEDKSGIKWIFSSIKKYKVFLIIFESNELGEEIYKEKISSKLPEYSYKTVAQIVDDGVKKNFFIKLDARAKTTKDLKIRNVRPSEEVIIEFINWKIDLLASLMKFKKDLIN* |
⦗Top⦘ |