3300003770: Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_5/23/2013_ DNA

Overview

Basic Information

• IMG/M Taxon OID: 3300003770
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0055735 | Gp0103142 | Ga0056912
• Sample Name: Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_5/23/2013_ DNA
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 170546538
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa
• Type: Engineered
• Taxonomy: Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment → Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Madison, Wisconsin, USA
• Coordinates
  • Lat. (^o): 43.076217
  • Long. (^o): -89.411742
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007648	Metagenome	347	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0056912_1028062	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium	850

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0056912_1028062	Ga0056912_10280621	F007648	MAVEITPEQEIWVMTTEGSEITGYNRQYLEKLAYKNWRLPENERVIKVRFRARRYEVWLPDLLRYIDEIGYGPHQNKQ*