NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003336

3300003336: Upper troposphere microbial communities - SEAC4RS-RF9-009



Overview

Basic Information
IMG/M Taxon OID3300003336 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0110167 | Gp0085224 | Ga0007670
Sample NameUpper troposphere microbial communities - SEAC4RS-RF9-009
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1236473
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Maledivibacter → Maledivibacter halophilus1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameUpper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei
TypeEnvironmental
TaxonomyEnvironmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Aerosol (non-saline)

Location Information
LocationUSA and various oceans
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032274Metagenome / Metatranscriptome180Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI25859J50179_10157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Maledivibacter → Maledivibacter halophilus520Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI25859J50179_10157JGI25859J50179_101571F032274DFTEQIEIVKHKRHKTLWTPKHDWRVAPKIIVTDEYIALDKKLEPIENELFXLIKQMPLAVEEKIKGKICVVNSGHTVDAELINRVRVLRKEASAIGKQLDELFFRTNKKWALFYDYTDKT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.