3300003336: Upper troposphere microbial communities - SEAC4RS-RF9-009

Overview

Basic Information

• IMG/M Taxon OID: 3300003336
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0110167 | Gp0085224 | Ga0007670
• Sample Name: Upper troposphere microbial communities - SEAC4RS-RF9-009
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 1236473
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Maledivibacter → Maledivibacter halophilus	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei
• Type: Environmental
• Taxonomy: Environmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Aerosol (non-saline)

Location Information

• Location: USA and various oceans
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032274	Metagenome / Metatranscriptome	180	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
JGI25859J50179_10157	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Maledivibacter → Maledivibacter halophilus	520

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI25859J50179_10157	JGI25859J50179_101571	F032274	DFTEQIEIVKHKRHKTLWTPKHDWRVAPKIIVTDEYIALDKKLEPIENELFXLIKQMPLAVEEKIKGKICVVNSGHTVDAELINRVRVLRKEASAIGKQLDELFFRTNKKWALFYDYTDKT*