NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003171

3300003171: Upper troposphere microbial communities from California, USA - DAQCA-005



Overview

Basic Information
IMG/M Taxon OID3300003171 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0110167 | Gp0085196 | Ga0007642
Sample NameUpper troposphere microbial communities from California, USA - DAQCA-005
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size8784446
Sequencing Scaffolds3
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pseudopneumoniae1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SRS21
All Organisms → Viruses → Predicted Viral1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameUpper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei
TypeEnvironmental
TaxonomyEnvironmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Aerosol (non-saline)

Location Information
LocationUSA: California
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032247Metagenome / Metatranscriptome180Y
F032274Metagenome / Metatranscriptome180Y
F055725Metagenome / Metatranscriptome138Y
F058997Metagenome / Metatranscriptome134N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI25831J46370_100021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pseudopneumoniae2485Open in IMG/M
JGI25831J46370_100137All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SRS21180Open in IMG/M
JGI25831J46370_100164All Organisms → Viruses → Predicted Viral1064Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI25831J46370_100021JGI25831J46370_1000214F032247MTIDDAIYNLEAYGRHMGNRFIAINHDRSYELLLKNAVIILEYAGMIERDTVKAWAHCNVRIINRDAERVDYTTGL*
JGI25831J46370_100137JGI25831J46370_1001371F032274MQGFFDFTEQIEIVKHKRHKTLWTPKHDWRVAPKIIVTDEYIALDKKLEPIENELFDLIKQMPLAVEEKIKGKICVVNSGHTVDAELINRVRVLRKEASAIGKQLDELFFRTNKKWALFYDYTDKT*
JGI25831J46370_100164JGI25831J46370_1001642F055725MAFFNGCGINLKTITELAAQGLSLNSMSKMTGHSKNGIKAALERNNIPYTMGIRECFITVDGVLTSLGDACNAQGFSRESMYAWRVKRGLNEQDGFDAYIIYQQSKRTIDKPILTFKNTTVIYKKERYTLDAISDKLKLNKQRFEVFMRHNRYGQNAFERYCWTRGL*
JGI25831J46370_100164JGI25831J46370_1001643F058997MIIYKDQQMTVREACKLMGIDCDDFMAWCKKFALQNYGYALNYYKRTLKFKKG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.