3300003127: Acid mine drainage microbial communities from Los Rueldos abandoned Hg mine in Spain - Sample B1B

Overview

Basic Information

• IMG/M Taxon OID: 3300003127
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0111449 | Gp0097858 | Ga0052266
• Sample Name: Acid mine drainage microbial communities from Los Rueldos abandoned Hg mine in Spain - Sample B1B
• Sequencing Status: Permanent Draft
• Sequencing Center: Institute of Catalysis, The Higher Council for Scientific Research (CSIC)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 14901674
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Acid Mine Drainage Microbial Communities From Los Rueldos Abandoned Hg Mine In Spain
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Acid Mine Drainage → Acid Mine Drainage Microbial Communities From Los Rueldos Abandoned Hg Mine In Spain

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → acid mine drainage → acidic water
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Vally of Mogao stream, Los Rueldos site, NW Spain
• Coordinates
  • Lat. (^o): 43.25
  • Long. (^o): -5.7666667
  • Alt. (m): N/A
  • Depth (m): .03 to .5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026917	Metagenome	196	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0052266_101312	All Organisms → cellular organisms → Bacteria → Proteobacteria	3213

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0052266_101312	Ga0052266_1013121	F026917	MTELDAAARQILEKVRMFLADETRFGVLSSGERIAVAVVLDRHDLIQRAWGTIAEAVDRLGPTWTAAALRVQRNGWQEDATE*