NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003086

3300003086: Marine viral communities from deep ocean hydrothermal plumes from the Lau and Guaymas Basin



Overview

Basic Information
IMG/M Taxon OID3300003086 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0097384 | Gp0097427 | Ga0052187
Sample NameMarine viral communities from deep ocean hydrothermal plumes from the Lau and Guaymas Basin
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Michigan
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size2311950
Sequencing Scaffolds3
Novel Protein Genes4
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHydrothermal Vent Plume Microbial Communities From Guaymas Basin, Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From Guaymas Basin, Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine hydrothermal vent biomemarine hydrothermal plumehydrothermal fluid
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationLau and Guaymas Basin
CoordinatesLat. (o)-20.053234Long. (o)-176.133763Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014191Metagenome / Metatranscriptome265Y
F036429Metagenome / Metatranscriptome170N
F105866Metagenome / Metatranscriptome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0052187_10045Not Available86515Open in IMG/M
Ga0052187_10046Not Available50322Open in IMG/M
Ga0052187_10081Not Available73697Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0052187_10005Ga0052187_100053F036429MATVKSVEITNLDATPRTTLEAASAGGKLRVWMDTIAVGTGDLDDDDIIILGQVPSNAKIVSLMIYNDDLNSGSGTHNVGLYNGPQAYTISGTTTAAAAVIDEDCYVTDSTAFRAAVTEPVELLAETRNINAIANFVWEDGGLSEDPKVPLRLAVTMSAVGTAIAGDITLVVKYTID*
Ga0052187_10045Ga0052187_1004590F014191MDLTFITAELLNDISWFDGIAYTVLGLVVYAVAKYINTKIN*
Ga0052187_10046Ga0052187_1004610F105866MATEDTGFTQIPYVRKDDTFKEWRERTNLMIQQQNNFVRMQEFDMLGVSDVWVKTSMQLNYSGETEN*
Ga0052187_10081Ga0052187_10081127F014191MDLRFITAELLNDISWFDGIMYIILGIGIYAIIKYINTKIN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.