3300002590: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS903_30_12H

Overview

Basic Information

• IMG/M Taxon OID: 3300002590
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0111355 | Gp0093355 | Ga0041812
• Sample Name: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS903_30_12H
• Sequencing Status: Permanent Draft
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 1547689
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Marker 113, Axial Seamount
• Coordinates
  • Lat. (^o): 45.922741
  • Long. (^o): -129.988104
  • Alt. (m): N/A
  • Depth (m): 1522

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019998	Metagenome / Metatranscriptome	226	N
F042865	Metagenome / Metatranscriptome	157	N

Associated Scaffolds

Scaffold	Taxonomy	Length
FS9033012H_10308	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	701
FS9033012H_10844	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus	510

Sequences

Scaffold ID	Protein ID	Family	Sequence
FS9033012H_10308	FS9033012H_103081	F042865	MSLRVPDYETFLAADDFNKRIWWQFMQSVVNDLPLNGNVAPENTIRANKSCLYVESTGGTAVLWFN
FS9033012H_10844	FS9033012H_108441	F019998	MWYKVNTVVGQVVNLYEVGTTTAASLDYAASVDAIVVGFTTLVWQPLRIIEARRKDLSSDIEVPLMIVGKFDYERIPNKAMTSIPLWLYAQTKIAETQVFVWPPTAYANWAIGYSFERRYQDVDSGINSMDFPPEAYESLRYGLAARLGDEFPIDPQRQAMLEQKAAGY