NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300002205

3300002205: Compost microbial communities from Sao Paulo Zoo, Brazil - ZC4 day 07



Overview

Basic Information
IMG/M Taxon OID3300002205 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0047180 | Gp0076433 | Ga0022210
Sample NameCompost microbial communities from Sao Paulo Zoo, Brazil - ZC4 day 07
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Sao Paulo, Virginia Bioinformatics Institute
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size151586253
Sequencing Scaffolds2
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameCompost Microbial Communities From Sao Paulo Zoo, Brazil
TypeEngineered
TaxonomyEngineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationSao Paulo Zoo, Brazil
CoordinatesLat. (o)-23.651072Long. (o)-46.620675Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001417Metagenome / Metatranscriptome699Y
F025338Metagenome / Metatranscriptome202Y
F098955Metagenome / Metatranscriptome103Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
metazooDRAFT_1274262All Organisms → cellular organisms → Bacteria516Open in IMG/M
metazooDRAFT_1310378All Organisms → cellular organisms → Bacteria → Proteobacteria699Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
metazooDRAFT_1274262metazooDRAFT_12742621F098955MDPSAIPVFLAGPFPVLHSANVLEREAEVQLDVGLIIGGLPTILAATSFPLDETWERVEAALSSGDARLGVAGIPFQVESPLGESEIFPSAYIGLECANGERLILAHIRGLDPNQDPES
metazooDRAFT_1277435metazooDRAFT_12774351F025338VVMGAVLIAGFRLATQMNANVAALQTASMLQTYPAALAQHLTSLRDRLEARAYAGQALADLRTTVESFDRDLKRLASGPAEGPMQIDQAMMLWRQYAPVLEPVLAFNGQPYIDTDEAGSVLSKEGLEHYADVKRAHLFARENADRLQGMLAAVATGLQQQASAQANRLRLLLSAG
metazooDRAFT_1310378metazooDRAFT_13103781F001417MDGSQLNAIHDALVSVQDAVTSMTFPSCDQEDVLELVDRVEAELQSPRPNLAVMCTFLNSIARSLRAQPEARDTCLAIEKAIGAAGMPSTWQSGI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.