Basic Information | |
---|---|
IMG/M Taxon OID | 3300002160 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0099546 | Gp0055085 | Ga0005352 |
Sample Name | Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge pinacoderm, lysed by proteinase K digestion |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 229758624 |
Sequencing Scaffolds | 4 |
Novel Protein Genes | 5 |
Associated Families | 4 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1 |
All Organisms → cellular organisms → Bacteria | 3 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Host-Associated Microbial Community Of The Marine Sponge Aplysina Aerophoba From Gulf Of Piran, Adriatic Sea |
Type | Host-Associated |
Taxonomy | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Community Of The Marine Sponge Aplysina Aerophoba From Gulf Of Piran, Adriatic Sea |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal corpus |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Gulf of Piran, Adriatic Sea | |||||||
Coordinates | Lat. (o) | 45.5099 | Long. (o) | 13.56 | Alt. (m) | N/A | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F005915 | Metagenome / Metatranscriptome | 386 | Y |
F030935 | Metagenome | 184 | Y |
F033719 | Metagenome | 176 | Y |
F105953 | Metagenome / Metatranscriptome | 100 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
JGI24797J26694_1027958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1339 | Open in IMG/M |
JGI24797J26694_1042556 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
JGI24797J26694_1050495 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
JGI24797J26694_1081370 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
JGI24797J26694_1027958 | JGI24797J26694_10279581 | F005915 | AMVLCGEDDKVERQGSTPVDTARRLGQATPGAELALIPGVRHMTFWDGTGAIEALEDFLARHPIG* |
JGI24797J26694_1042556 | JGI24797J26694_10425562 | F030935 | GTARMLGQAIPGAELALIPGVRHMTFWDGTGALTALQDFLKRHPIQ* |
JGI24797J26694_1050495 | JGI24797J26694_10504951 | F033719 | MDHRTSADILANGIPGARLVLLAGERHSYFFANPEASFKAIREFL* |
JGI24797J26694_1058768 | JGI24797J26694_10587682 | F105953 | REPLHVAKGYPAKDERTTAAECLLLKPSEVLEQVEEGLSGGQHFELIENEDLMVEMTVRSDSQRIYHRGFNQDEVAFQLTGQRGTRTTQGEFMLDTGDMLWIPPGCSHRNIGDMLTTRIILYTRNPLTLSREYTSRAEQVGQAG* |
JGI24797J26694_1081370 | JGI24797J26694_10813701 | F033719 | SDMNHRTSSEILENGIPGAELVVLPGERHSYFFANPEAAHAAVRDFLARI* |
⦗Top⦘ |