NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001630

3300001630: Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037



Overview

Basic Information
IMG/M Taxon OID3300001630 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0085736 | Gp0057362 | Ga0003876
Sample NameForest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size4380169
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameForest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies

Alternative Ecosystem Assignments
Environment Ontology (ENVO)forest biomelandforest soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationHarvard Forest LTER, Petersham, MA, USA
CoordinatesLat. (o)42.550409Long. (o)-72.180244Alt. (m)N/ADepth (m)0 to .1
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007427Metagenome / Metatranscriptome351Y
F019167Metagenome / Metatranscriptome231Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI20271J16308_100226Not Available594Open in IMG/M
JGI20271J16308_100400Not Available522Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI20271J16308_100226JGI20271J16308_1002261F007427PIDIALLEYATLGIFVLAGLAVLLVTTAPVHERVAFVFFVLQLGLLSSQIWTSTFGEGRSLIEPYLMALILLLATPRHYLSWRYLGLIVACVAPALAIVARRRILYM*
JGI20271J16308_100400JGI20271J16308_1004001F019167VTTVRIVFAQHIRPARAPDGSDVPDFRLHQQLIVLADDAGHRAVPLWLRIQKGLRARVARLDRPAGDAEVASGLLETAVRLLGTAGTAVSAVDIEPASDDV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.