Basic Information | |
---|---|
IMG/M Taxon OID | 3300001525 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0095260 | Gp0057791 | Ga0012980 |
Sample Name | Chimp virome sample 4 |
Sequencing Status | Permanent Draft |
Sequencing Center | |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 304720290 |
Sequencing Scaffolds | 5 |
Novel Protein Genes | 5 |
Associated Families | 4 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 1 |
Not Available | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Primate Fecal Viral Communities From Gombe National Park, Tanzania |
Type | Host-Associated |
Taxonomy | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Primate Fecal → Primate Fecal Viral Communities From Gombe National Park, Tanzania |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Gombe National Park, Tanzania | |||||||
Coordinates | Lat. (o) | -4.4 | Long. (o) | 29.38 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F029589 | Metagenome / Metatranscriptome | 188 | Y |
F056682 | Metagenome | 137 | Y |
F076190 | Metagenome | 118 | Y |
F092227 | Metagenome | 107 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
chfec4_10000407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 29586 | Open in IMG/M |
chfec4_10012629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 2862 | Open in IMG/M |
chfec4_10067737 | Not Available | 852 | Open in IMG/M |
chfec4_10124865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 558 | Open in IMG/M |
chfec4_10136984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 523 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
chfec4_10000407 | chfec4_1000040726 | F092227 | MNEQKRKRILRVGCLLLAGVFLLSVLGSVILMLLV* |
chfec4_10012629 | chfec4_100126297 | F076190 | VRTAGGSITTPAGNAPTAASRVSGRAWWLARITAPNGLKSVKIRVGKPQNNPLYPHFQREPL* |
chfec4_10067737 | chfec4_100677372 | F029589 | MKEYEIVIKCTNACAGSSRPQTFFEEAELENPAGYIREKHGRDFEKFQEEVLPDGRIVYSWDNGSVAYHYEFTEL* |
chfec4_10124865 | chfec4_101248652 | F092227 | MNEQKHKRWLRIGCLILAGVFALSLLSSVIMMLLF* |
chfec4_10136984 | chfec4_101369842 | F056682 | MKTLSRAGKVANQPIGQGKMYSASFRVFLLKNHITFPFQELGKIYKNQEVL* |
⦗Top⦘ |