NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001357

3300001357: Combined assembly of Elkhorn Slough mat metaG (MD2A, MD6A, CD2A, CD6A)



Overview

Basic Information
IMG/M Taxon OID3300001357 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0067861 | Gp0053859 | Ga0081572
Sample NameCombined assembly of Elkhorn Slough mat metaG (MD2A, MD6A, CD2A, CD6A)
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size829358478
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSaline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Microbial Mats → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationElkhorn Slough, Monterey Bay, California, USA
CoordinatesLat. (o)36.82188Long. (o)-121.744Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015419Metagenome / Metatranscriptome255Y
F056191Metagenome / Metatranscriptome138Y
F102160Metagenome102Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI11876J14442_10000001All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales241034Open in IMG/M
JGI11876J14442_10015051All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5188Open in IMG/M
JGI11876J14442_10068415Not Available1669Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI11876J14442_10000001JGI11876J14442_10000001299F102160MLTMILFALMVSVFISYVAYIIFKYGIQKSISESYYVLPKKLNFLFVLFTWLFAIPAMFLGNSLLMFFAGGGIVWVGANAAMHKNPTRTIHLIAAIGGMILGGLAMIFQYHMWYMTAGVAGLLPILYLVDKKHFMFWAELAVFIAITITLGVNIF*
JGI11876J14442_10015051JGI11876J14442_100150512F015419MKYELKITDEQGNEHLYNVVRSSSDEPKNLNDFILEALSISEXKRXLPXLXQCPNGLEVHPSIKMKFKDYGSSLVGDKLEAMMVTWRCLVLK*
JGI11876J14442_10068415JGI11876J14442_100684152F056191MFLLRASMHLLLPCIKCEARVRHALTAEMFKTFPSGGSMHASVKLEGIDGRAPQERVEHVA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.