NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000519

3300000519: Amended soil microbial communities from Kansas Great Prairies, USA - acetate and BrdU F2.1B



Overview

Basic Information
IMG/M Taxon OID3300000519 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0051396 | Gp0054041 | Ga0026756
Sample NameAmended soil microbial communities from Kansas Great Prairies, USA - acetate and BrdU F2.1B
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size71016757
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata1
All Organisms → cellular organisms → Bacteria2
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Kansas Great Prairie, Usa, Amended With Brdu
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From Kansas Great Prairie, Usa, Amended With Brdu

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeprairiesoil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationKanza Prairie, Kansas, USA
CoordinatesLat. (o)39.100992Long. (o)-96.608258Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040189Metagenome / Metatranscriptome162Y
F077438Metagenome / Metatranscriptome117Y
F077781Metagenome / Metatranscriptome117N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
RepKanNP_Acetate_BrdU_F21BDRAFT_1003286All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata1580Open in IMG/M
RepKanNP_Acetate_BrdU_F21BDRAFT_1004337All Organisms → cellular organisms → Bacteria1250Open in IMG/M
RepKanNP_Acetate_BrdU_F21BDRAFT_1004355Not Available1246Open in IMG/M
RepKanNP_Acetate_BrdU_F21BDRAFT_1005741All Organisms → cellular organisms → Bacteria1010Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
RepKanNP_Acetate_BrdU_F21BDRAFT_1003286RepKanNP_Acetate_BrdU_F21BDRAFT_10032861F077781AAPARPAPAHLKAPAAVTGGWGSPRQNDFFILLTLESPAPCDPLQTESHLVFRTRIHSQVQWGDVRGVAGRTKDSLPSDSVCTVGPRAGALSVRTADSLYLGFPRPHPGTPGLGRFWPFLALQSLSETPSHARMPRVTVARTSPETLEISPLRAAT*NHRSSGHTCFRERMLRVSCRLSLDLSSSWVRG*
RepKanNP_Acetate_BrdU_F21BDRAFT_1004337RepKanNP_Acetate_BrdU_F21BDRAFT_10043371F077438HRVERSFTQSRFETLFFWNLQVEISAALRSMVEKEISSYKN*
RepKanNP_Acetate_BrdU_F21BDRAFT_1004355RepKanNP_Acetate_BrdU_F21BDRAFT_10043552F040189PPNYTTQNVLYGVGILFTAIPGTTVPSDQNLGVASAWTGLGWAYVGATEAGLTVTFNPSTQDLNIEEQPTPVAVIVNTATLQVTCSLSEETLTNVNMAWGNGGSIAVTPAGAGQPGKSVLTLSTNFASMACAVIGRNQQGYARVLSIPQVMAAGQVQTAYRRAAQQRLYPLTLNATCPFNQISWTDLTAVATS*
RepKanNP_Acetate_BrdU_F21BDRAFT_1005741RepKanNP_Acetate_BrdU_F21BDRAFT_10057411F077438VYSTHTVERWFTQSRFETLFLWNLQVEISAALRSMVE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.