Basic Information | |
---|---|
IMG/M Taxon OID | 2228664019 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0045332 | Gp0051641 | Ga0010738 |
Sample Name | Nasutitermes corniger hindgut microbial communities from Florida, USA - 2 |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 36853872 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus | 1 |
All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Termite Hindgut Microbial Communities From Amitermes Wheeleri In The Arizona Desert And From Nasutitermes Corniger In Florida, Usa |
Type | Host-Associated |
Taxonomy | Host-Associated → Arthropoda → Digestive System → Hindgut → P3 Segment → Termite Hindgut → Termite Hindgut Microbial Communities From Amitermes Wheeleri In The Arizona Desert And From Nasutitermes Corniger In Florida, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Florida, USA | |||||||
Coordinates | Lat. (o) | 26.135833 | Long. (o) | -80.129444 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F005119 | Metagenome / Metatranscriptome | 411 | Y |
F026033 | Metagenome / Metatranscriptome | 199 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
NasMGMT1_c112714 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus | 660 | Open in IMG/M |
NasMGMT1_c112717 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 517 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
NasMGMT1_c112714 | NasMGMT1_1127142 | F026033 | MEFQRTGRYDLMYMKTKELGWKENQGIQNIGIEDSQGNRIVEQSQVLKIWENYITELHDRPNRPVTLEVEPEEEVDADEKGPYILRSEVEKAIKEMRNKKATGDDDTPGDVFKLLGEGGLKIMTKLINTIYETGEWPKAFTEVTMIALKKKPQATKCSDHRT |
NasMGMT1_c112717 | NasMGMT1_1127172 | F005119 | MRHDKVCTHLHYSICKALGIETADKWYTHMPKPVYEEGDVTVLWNQAVHTDREVTANRPDIIIKNKK |
⦗Top⦘ |