2156126008: Estuarine microbial communities from Columbia River, CM, sample from South Channel ETM site, CRE-ETM-794-796-2nd

Overview

Basic Information

• IMG/M Taxon OID: 2156126008
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0047387 | Gp0052381 | Ga0010917
• Sample Name: Estuarine microbial communities from Columbia River, CM, sample from South Channel ETM site, CRE-ETM-794-796-2nd
• Sequencing Status: Permanent Draft
• Sequencing Center: University of South Carolina
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 25218411
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine And Estuarine Microbial Communities From Columbia River Coastal Margin
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → estuary → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Columbia River estuary, South Channel ETM site near Astoria (OR)
• Coordinates
  • Lat. (^o): 46.201
  • Long. (^o): -123.821
  • Alt. (m): N/A
  • Depth (m): 14

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067258	Metagenome / Metatranscriptome	126	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
G0UEUZL07ISJV2	Not Available	508

Sequences

Scaffold ID	Protein ID	Family	Sequence
G0UEUZL07ISJV2	G0UEUZL07_0575.00000010	F067258	TTTPSRRGVLSSPCPWARGFTRLSTAYVTFWDSTGKYANRFNSVVALGAGNPNTTTSDGASWNITIGADRFPDFDVDSVQEAWHRLGVAQLMHVGKDSFSISPYQYRTDKHIAAMSFEKALGEAGHSGVNTRAGSQLTFNIRGLPCDHPTPSNVVLHFEVRCQYLRRG