Basic Information | |
---|---|
IMG/M Taxon OID | 2149837018 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0047181 | Gp0052354 | Ga0010878 |
Sample Name | Human fecal microbial communities from the University of Arizona (HMP) - Em1 |
Sequencing Status | Permanent Draft |
Sequencing Center | Chinese National Human Genome Center, Beijing |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 18920902 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 1 |
All Organisms → cellular organisms → Bacteria | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Fecal Microbial Communities From The University Of Arizona, For Hmp Training |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From The University Of Arizona, For Hmp Training |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Bording, Denmark | |||||||
Coordinates | Lat. (o) | 56.13 | Long. (o) | 9.24 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F042936 | Metagenome | 157 | N |
F067844 | Metagenome | 125 | N |
F090513 | Metagenome | 108 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
STU__NODE_10381_len_662_cov_8_090634 | Not Available | 690 | Open in IMG/M |
STU__NODE_12424_len_686_cov_13_258018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 714 | Open in IMG/M |
STU__NODE_5850_len_562_cov_26_049822 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
STU__NODE_10381_len_662_cov_8_090634 | STU_0980.00000620 | F042936 | LRQGPFCCVRLMGRGGGKGRVWKTKEGIMKTSGIVDRGEDTIRNFEKVEQEGALTPPYLGKVYFRSRLRGKG |
STU__NODE_12424_len_686_cov_13_258018 | STU_0652.00000530 | F090513 | MAKYVRKMEWKLLHIKHILYMQPFGALKIAPQSVENKNGTKAVLQGWAAAFVPYMLSFT |
STU__NODE_5850_len_562_cov_26_049822 | STU_0173.00000250 | F067844 | MNTLAAETTSAWYLILNRKRQTLPIYISQLSSHLPRPLTMGTQQVSAGAAVITPQ |
⦗Top⦘ |