NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2070309002

2070309002: Concrete drainage pipe biofilm microbial communities from Ohio, US - sample 12382, Newbler assembly



Overview

Basic Information
IMG/M Taxon OID2070309002 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0046156 | Gp0051714 | Ga0011042
Sample NameConcrete drainage pipe biofilm microbial communities from Ohio, US - sample 12382, Newbler assembly
Sequencing StatusPermanent Draft
Sequencing Center454 Life Sciences
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size59718321
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → Acidiphilium cryptum1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameConcrete Drainage Pipe Biofilm Microbial Communities From Ohio, Us
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm Microbial Communities From Ohio, Us

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biomeartificial channelbiofilm material
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Surface (non-saline)

Location Information
LocationOhio, USA
CoordinatesLat. (o)39.8Long. (o)-84.3Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F045179Metagenome / Metatranscriptome153Y
F046787Metagenome150Y
F054662Metagenome139Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
MiccSOB_contig04015All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → Acidiphilium cryptum3212Open in IMG/M
MiccSOB_contig04068All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage530Open in IMG/M
MiccSOB_contig38790Not Available1164Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
MiccSOB_contig04015MiccSOB_00069900F046787MSESDKPLRQQIDDAMAAIRKQIERLREGPTMGGPSDDRSVIADLQAEYQALAEVRTNLPPHDHPSDHPDDATPA
MiccSOB_contig04068MiccSOB_01092890F054662KVNMREQRRELRLRFDSNAQGGDYYMGRILLTLNVGDVRSTGNP
MiccSOB_contig38790MiccSOB_00249930F045179MIQMTSAFLMSVQLFVIAPRPNVGPKLATVGPCQILALVFDLQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.