Basic Information | |
---|---|
IMG/M Taxon OID | 2070309002 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0046156 | Gp0051714 | Ga0011042 |
Sample Name | Concrete drainage pipe biofilm microbial communities from Ohio, US - sample 12382, Newbler assembly |
Sequencing Status | Permanent Draft |
Sequencing Center | 454 Life Sciences |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 59718321 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → Acidiphilium cryptum | 1 |
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1 |
Not Available | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Concrete Drainage Pipe Biofilm Microbial Communities From Ohio, Us |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm Microbial Communities From Ohio, Us |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | aquatic biome → artificial channel → biofilm material |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Surface (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Ohio, USA | |||||||
Coordinates | Lat. (o) | 39.8 | Long. (o) | -84.3 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F045179 | Metagenome / Metatranscriptome | 153 | Y |
F046787 | Metagenome | 150 | Y |
F054662 | Metagenome | 139 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
MiccSOB_contig04015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → Acidiphilium cryptum | 3212 | Open in IMG/M |
MiccSOB_contig04068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
MiccSOB_contig38790 | Not Available | 1164 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
MiccSOB_contig04015 | MiccSOB_00069900 | F046787 | MSESDKPLRQQIDDAMAAIRKQIERLREGPTMGGPSDDRSVIADLQAEYQALAEVRTNLPPHDHPSDHPDDATPA |
MiccSOB_contig04068 | MiccSOB_01092890 | F054662 | KVNMREQRRELRLRFDSNAQGGDYYMGRILLTLNVGDVRSTGNP |
MiccSOB_contig38790 | MiccSOB_00249930 | F045179 | MIQMTSAFLMSVQLFVIAPRPNVGPKLATVGPCQILALVFDLQ |
⦗Top⦘ |