Basic Information | |
---|---|
IMG/M Taxon OID | 2010549000 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0056620 | Gp0052103 | Ga0026419 |
Sample Name | Rice endophytes microbial communities from Berkeley, California, USA |
Sequencing Status | Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 46747680 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Rice Endophytes Microbial Communities From The International Rice Research Institute, Philippines |
Type | Host-Associated |
Taxonomy | Host-Associated → Plants → Rhizoplane → Endophytes → Unclassified → Rice Endophytes → Rice Endophytes Microbial Communities From The International Rice Research Institute, Philippines |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Philippines: Los Banos | |||||||
Coordinates | Lat. (o) | 14.1677 | Long. (o) | -121.2523 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F021566 | Metagenome / Metatranscriptome | 218 | Y |
F080249 | Metagenome / Metatranscriptome | 115 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
RicEn_FSXC3319_g1 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
RicEn_FSXC82502_b1 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
RicEn_FSXC3319_g1 | RicEn_196220 | F080249 | MIDATQRETPMTDNKQNKGTPDRNLISFKQKYEFDYAVKQLQKQIPDTTRQEAKDALAAAAKKISPSEGREKIMRAARKTLRD |
RicEn_FSXC82502_b1 | RicEn_592700 | F021566 | MFTCKSYDKFTARVLAGLVLAVTIVFGSLTYAVSNVQAYI |
⦗Top⦘ |