NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2010549000

2010549000: Rice endophytes microbial communities from Berkeley, California, USA



Overview

Basic Information
IMG/M Taxon OID2010549000 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0056620 | Gp0052103 | Ga0026419
Sample NameRice endophytes microbial communities from Berkeley, California, USA
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size46747680
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameRice Endophytes Microbial Communities From The International Rice Research Institute, Philippines
TypeHost-Associated
TaxonomyHost-Associated → Plants → Rhizoplane → Endophytes → Unclassified → Rice Endophytes → Rice Endophytes Microbial Communities From The International Rice Research Institute, Philippines

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Plant → Plant rhizosphere

Location Information
LocationPhilippines: Los Banos
CoordinatesLat. (o)14.1677Long. (o)-121.2523Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021566Metagenome / Metatranscriptome218Y
F080249Metagenome / Metatranscriptome115Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
RicEn_FSXC3319_g1All Organisms → cellular organisms → Bacteria798Open in IMG/M
RicEn_FSXC82502_b1All Organisms → cellular organisms → Bacteria670Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
RicEn_FSXC3319_g1RicEn_196220F080249MIDATQRETPMTDNKQNKGTPDRNLISFKQKYEFDYAVKQLQKQIPDTTRQEAKDALAAAAKKISPSEGREKIMRAARKTLRD
RicEn_FSXC82502_b1RicEn_592700F021566MFTCKSYDKFTARVLAGLVLAVTIVFGSLTYAVSNVQAYI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.