2010484004: Acid Mine Drainage (ARMAN) microbial communities from Richmond mine, Iron Mountain, CA, sample from Ultra Back A BS

Overview

Basic Information

• IMG/M Taxon OID: 2010484004
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053288 | Gp0051182 | Ga0026418
• Sample Name: Acid Mine Drainage (ARMAN) microbial communities from Richmond mine, Iron Mountain, CA, sample from Ultra Back A BS
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI), University of California, Berkeley
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 20656958
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1
All Organisms → cellular organisms → Bacteria → Proteobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Acid Mine Drainage (Amd) Microbial And Viral Communities From Richmond Mine, Iron Mountain, Ca
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Acid Mine Drainage (Amd) → Acid Mine Drainage (Amd) Microbial And Viral Communities From Richmond Mine, Iron Mountain, Ca

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → acid mine drainage → acidic water
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Iron Mountain California
• Coordinates
  • Lat. (^o): 40.678099
  • Long. (^o): -122.515068
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026917	Metagenome	196	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
UBABS_BWON22702_y1	Not Available	823
UBABS_C202	All Organisms → cellular organisms → Bacteria → Proteobacteria	1098

Sequences

Scaffold ID	Protein ID	Family	Sequence
UBABS_BWON22702_y1	UBABS_240240	F026917	MIHAADMCDAERQIRQKVIMVVADETRFGTLSTGERIAVALVLERYDLLQRAWGRMLESVHRLGPLWTEAALRVQRQGWEEDPTS
UBABS_C202	UBABS_04730	F026917	MTELDAAARQILEKVRMFLADETRFGVLSSGERIAVAVVLDRHDLIQRAWGTIAEAVDRLGPTWTAAALRVQRNGWQEDATE