NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2009439003

2009439003: 1_050719N



Overview

Basic Information
IMG/M Taxon OID2009439003 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0055739 | Gp0050995 | Ga0026300
Sample Name1_050719N
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size26884788
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3
All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis → Thermocrinis ruber1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHot Spring Microbial Communities From Bison Spring, Yellowstone National Park, Usa, Analyzing Thermal Gradients
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Bison Spring, Yellowstone National Park, Usa, Analyzing Thermal Gradients

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biomehot springspring water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationBison Pool, Yellowstone National Park
CoordinatesLat. (o)44.6Long. (o)-110.9Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021443Metagenome / Metatranscriptome219Y
F043237Metagenome / Metatranscriptome156Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
bisonPool05dec07_BXBC24877_b1Not Available759Open in IMG/M
bisonPool05dec07_C5403Not Available1479Open in IMG/M
bisonPool05dec07_C574All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis → Thermocrinis ruber4389Open in IMG/M
bisonPool05dec07_C6035Not Available1157Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
bisonPool05dec07_BXBC24877_b1BISONN_35593F021443YQNNGILSFAVMDLVFKIIKQQKRKSIILKKRKPIIHLLNYIDILNFNFKSNEFNIILSLKNNYKTQLTYNLYLHRSSYRRRYYEGFYKDSLKVIERENLCIIKLEDDFPAEIQPKNLNLATILMHILDKEEIDMINGNGIIFYCVFLM
bisonPool05dec07_C5403BISONN_18613F043237MDLEKTAKYIAQLSARGYKYAIIGQLSGYNRKLVKRLEYDGFVFYLCRLQTKKEVIAYCLERTDKPFKVYCLSSKPLEFPNAPLKLHYDEKTQRLRLLCQKSFISDCLNAIEKASEVKYPSPKLYIAQVNKALRQLYSVLAYTYNDRERVRAIRRKVKHWVVEALKRQYGLKPKDA
bisonPool05dec07_C574BISONN_1943F043237MELERTARYIAQLSSRGYKYAVVGKLARYDKKLVKRLEYEGFVFYLCRFQTKKEVVEYCLERAEGTFRVYCLSAKPLEFPNAPLKLHYDEKTGRLRLLAQRSFINECLRVIERASSLKYPNHKLYTIKVNEALRNLYSILAYTYNDRERLRAIKRKVKHLFVSALKENYGIEPKKAMEEYRRFVVKFSDVLRKKQRANSSTS
bisonPool05dec07_C6035BISONN_20752F043237QFPSRPLPKKIQEETMDLEKTAKYIAQLSRHGYRYAIIGKLVRYDREKVKRLEYDGFVFYLCRLPSKKEVIAYCLPRSEGLFRVYCLSSKPLEFPNAPLKLHYDEKTQRLRLLCQKSFINDCLNAIEKASEVKYPSPKLYIAQVNKVLRQLYEILAYTYNDRERVRAIKRKVKHWVVEALESQYGLKPKDAMIDYSRYVLKFSDVLKRKRQKATKE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.