NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2007309001

2007309001: Hot spring planktonic communities from Yellowstone Bath Hot Springs, Wyoming, USA



Overview

Basic Information
IMG/M Taxon OID2007309001 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0045212 | Gp0051060 | Ga0027798
Sample NameHot spring planktonic communities from Yellowstone Bath Hot Springs, Wyoming, USA
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size20451936
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biomehot springspring water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationUSA: Wyoming
CoordinatesLat. (o)44.560318Long. (o)-110.8338344Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013155Metagenome / Metatranscriptome274Y
F024322Metagenome / Metatranscriptome206N
F054062Metagenome / Metatranscriptome140N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
2007327490Not Available784Open in IMG/M
2007327491Not Available810Open in IMG/M
2007331210Not Available689Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
20073274902007346216F054062VLRWKEFCDGLDKDPPEDIQKEAEHIFFDHVFPEVLLTFFQNASELLLLYEAALSAPAMKPIADAKFNELFRQSPIPFYESLVPVLKNLGAEPEKATFLEICAFLTTYKS
20073274912007346217F024322MSLLRKLRNARQWRYLRLVDPILQRYEFCPVWANYLTPPSPVQVDTSVGTLTIQTGLVRSFAREYDISTYSFPFSAEERVGFYPPPVLMAHYNEFSQIAARLQHAFMVVVPDARFGKSEWGEVEFDAFFFAPAVDSEEFESQLDRIAGLRGSFVELWPKMVTFTEIIPKFSRRAEWGNGEKLVKGEWIAIRLTINLKDYELNAV
20073312102007350929F013155MELYQIIVVAIALANLAVTVWLLRLLLPVWRTLRKVVFVLDQYDFDRLAKQFLSNEKPVAETIDIKVSEKKEEGYKELTVTRVYKRPLNPKEIQEGFVRQMAERLQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.