NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2001200004

2001200004: Fossil microbial communities from Whale Fall, West Antarctic Peninsula - Bone



Overview

Basic Information
IMG/M Taxon OID2001200004 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0055718 | Gp0050981 | Ga0028837
Sample NameFossil microbial communities from Whale Fall, West Antarctic Peninsula - Bone
Sequencing StatusFinished
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size30784116
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFossil Microbial Community From Whale Fall, Santa Cruz Basin Of The Pacific Ocean And West Antarctic Peninsula
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Fossil → Whale Fall → Fossil → Fossil Microbial Community From Whale Fall, Santa Cruz Basin Of The Pacific Ocean And West Antarctic Peninsula

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomecoastal water bodyfossil
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Surface (saline)

Location Information
LocationSanta Cruz Basin, Pacific Ocean
CoordinatesLat. (o)-65.1Long. (o)-64.47Alt. (m)N/ADepth (m)1670
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F073087Metagenome120Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
2001413554Not Available859Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
20014135542001511754F073087MNTQHQTSFTKAIIGSTQRLFRSNKNHSLLANSFINARTMKDIGVNPVGLN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.