Scaffold SRS054430_LANL_scaffold_19104

Overview

Basic Information

• Taxon OID: 7000000674
• Scaffold ID: SRS054430_LANL_scaffold_19104
• Source Dataset Name: Human supragingival plaque microbial communities from the National Institute of Health, USA - subject 159490532, visit 2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3365
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location

• Location Name: National Institutes of Health, USA
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057446	Metagenome	136	N

Sequences

Protein ID	Family	RBS	Sequence
SRS054430_LANL_scaffold_19104__gene_20295	F057446	N/A	MNSISFGKTTITSYPEYFEIADNKKTNKLLYLSASFVFIAIYLFDLYQNDFDFGKVSHFKTISAVLWLVIFALQFWLINTESKIEKSKIKEVVVRKNRWASIVIHYEDKKRKIDGFSQEEAEQIIKFLMNNR