Basic Information | |
---|---|
Taxon OID | 7000000107 Open in IMG/M |
Scaffold ID | C2655202 Open in IMG/M |
Source Dataset Name | Human stool microbial communities from NIH, USA - visit 2, subject 764447348 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 655 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Maryland: Natonal Institute of Health | |||||||
Coordinates | Lat. (o) | 39.0042816 | Long. (o) | -77.1012173 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F090513 | Metagenome | 108 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
C2655202__gene_160605 | F090513 | N/A | MAKYVRKMEWKLLHIKHILYMQPFGALKIAPQSVGNKNGTKAVLQGWAAA |
⦗Top⦘ |