Scaffold Ga0373959_0181520

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0373959_0181520

Scaffold Ga0373959_0181520

Overview

Basic Information
Taxon OID	3300034820 Open in IMG/M
Scaffold ID	Ga0373959_0181520 Open in IMG/M
Source Dataset Name	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	547
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil → Populus Rhizosphere Microbial Communities From Soil In West Virginia And Oregon, United States

Source Dataset Sampling Location
Location Name	USA: West Virginia, United States
Coordinates	Lat. (^o)	39.6589	Long. (^o)	-79.9058	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074060	Metagenome / Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0373959_0181520_107_532	F074060	N/A	VLRQKKAVQTLVPDLTTELVKIVAADWVRYDLEDQGKLWSRSIKPGGEAQRPGLGEVPRIKSTEAEYAKEIEGGFEACLLLGIGETSGRLLLRRRSPAFSEDDLKKLRAVADVLSLGLRARPFEPPPKPRGPFDEEPGAMI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.